KEGG   Glaciecola psychrophila: C427_4472Help
Entry
C427_4472         CDS       T02535                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
gps  Glaciecola psychrophila
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:gps00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4326673..4327248
Genome map
AA seq 191 aa AA seqDB search
MAQLYFYYSAMNAGKSTSLLQSAYNYAERGMNAEIFTAALDNRYGEGKVASRIGLESAAH
LFTPQTDMQSAVEALVAKKKVNCLFIDEAQFLTKQQVKQLIYVVDNLNIPVLAYGLRTDF
LAETFEGSRYLLAWADKLIELKTICHCGRKAAFVVRIDENGQVVKEGEQVEVGGNDKYES
MCRQHFAKLVW
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaactttacttctattactcggcaatgaacgcaggcaaatctacttctttgctg
cagtcagcttacaattatgccgaaagaggcatgaatgctgaaatttttactgctgcatta
gacaataggtacggtgaaggcaaagtagcgtccagaataggtcttgaatcggcagctcac
cttttcacccctcaaaccgatatgcaatctgcagttgaagcgctagtggccaaaaaaaag
gtaaactgtctgtttatcgatgaagcgcaatttttaacgaagcaacaagtaaagcaatta
atttatgtggtcgacaacctcaacatacccgtattggcatatggccttcggacagacttt
ttagcagaaacctttgaaggtagccgctaccttttggcatgggctgacaaactgatagag
ttgaaaactatctgccattgtggtcgaaaagcagcatttgtagtcagaatcgatgaaaat
ggacaagtagtaaaagaaggcgaacaggtagaggtgggtggaaatgataaatacgagtcg
atgtgcagacaacacttcgcaaagcttgtatggtaa

DBGET integrated database retrieval system