KEGG   Glaciecola psychrophila: C427_5060Help
Entry
C427_5060         CDS       T02535                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gps  Glaciecola psychrophila
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gps00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4874781..4875335
Genome map
AA seq 184 aa AA seqDB search
MSDKLAGHYSDILSILGEDVSRGGLVDTPQRAAKAMQFLTDGYQKDLDGVVNGAIFEADT
DEMVIIQDIEFYSLCEHHILPFIGRCHIAYLPNGKVLGLSKFARIVDMFARRLQIQEGLT
KQIADAVQKVTGATGVGVIMEGKHMCMMMRGVQKQNSSMITSVMLGSMRTSDATRNEFLR
LIGK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtcagataaattagccggccactattcagatatcctttcaatcttaggggaggatgtt
agccgcggtggattagtagatacgccccaacgcgcggccaaagcaatgcaatttttaact
gatggttatcaaaaagatttagatggcgttgtaaatggggctattttcgaagcagacaca
gatgaaatggtcattatacaagacatcgagttctactcattgtgtgaacatcatatttta
ccttttatcggacgttgccatattgcctacctacccaatggcaaagtgttggggttatca
aagtttgctcgcattgttgatatgttcgctagacgtttacaaatccaagaagggttaacc
aaacaaattgccgatgccgtgcaaaaagtgactggcgctacaggtgtaggggtgattatg
gaaggtaaacacatgtgtatgatgatgcgcggtgtacaaaagcagaattcttctatgata
acttcagtgatgttaggctctatgcgcacatctgatgccacccgtaatgaatttttgcgc
ttaatcggtaaataa

DBGET integrated database retrieval system