KEGG   Glaciecola psychrophila: C427_5203Help
Entry
C427_5203         CDS       T02535                                 

Definition
stearoyl-CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
gps  Glaciecola psychrophila
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gps00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    C427_5203
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    C427_5203
Enzymes [BR:gps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     C427_5203
Lipid biosynthesis proteins [BR:gps01004]
 Desaturase
  First
   C427_5203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5003962..5005098
Genome map
AA seq 378 aa AA seqDB search
MKKPRLLLTNILIFTITGLIATVLVPFEAFKNGFDAVEIISCIALIYFSGMSITAGYHRL
WSHKSYQANAFVRIVLAIGGAMSLQNSILHWCSDHRIHHKHVDDNEQDPYSAKKGFWYSH
IGWMLREYQIHRYADYNNCRDLQKDAVIIWQHKHYLKIMFAANFGVPVLLGWLNGDIWGM
LLLAGVFRLVVVHHVTFFINSLAHIWGKQPYTDKNTARDNDILAFFTFGEGYHNFHHIFE
YDYRNGIKWWQFDPTKWLIKGLSFIGWTSNLRRCPEERIEKAKAAMQLKLAQEKVSKLAN
ADEILAKVHFEYELLAQRMTDYYAAKKQLMAIKKQNLKRTYENLEVHYRYKELKQSLALQ
KQKWIHINQFDFLPVMAE
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccacgcctactgctgaccaatatcttaatatttactattaccgggcttata
gccactgtgttggtgccctttgaagcatttaaaaatggctttgatgccgttgaaattatc
tcgtgtatcgctttaatttacttttcaggcatgtcgattactgccggttaccatcgttta
tggtctcataaatcataccaagccaacgcatttgtcagaatagtattggcaataggtgga
gcaatgtcgttacaaaacagcatattgcattggtgttcagatcatcgtatccaccacaaa
catgttgacgataacgaacaagacccatattcagccaaaaaagggttctggtattctcat
attggttggatgttaagagagtatcaaatccacagatatgctgattataataactgccgc
gatcttcagaaagatgcggtaataatatggcagcataaacactatttaaaaatcatgttt
gcggcaaacttcggcgtccctgttttgttgggttggctgaatggtgatatctggggcatg
ctgttgttagcaggtgttttccgtttagttgtagttcatcacgtcacttttttcataaat
tccctagctcatatatggggaaagcaaccttacactgataaaaatactgctcgtgataac
gatatcctcgcctttttcacttttggagagggatatcataatttccaccatatatttgaa
tatgattacagaaacggcataaagtggtggcaatttgacccaacaaaatggttaattaaa
ggtttatcctttattggctggaccagtaatcttcgtcgctgcccagaagaaaggattgaa
aaagctaaggctgccatgcaactaaaattagcccaagaaaaagtatctaaattagctaat
gcagatgagatattagccaaagtgcactttgaatacgaacttttagcccagcgcatgacc
gactattacgcggcaaaaaaacaactaatggccatcaaaaaacaaaacttgaaacgcacc
tatgagaaccttgaagttcactacagatataaagagttaaagcaaagtttagcccttcaa
aagcaaaaatggatacatatcaatcagttcgactttttgcctgtcatggccgagtaa

DBGET integrated database retrieval system