KEGG   Glaciecola psychrophila: C427_5203Help
Entry
C427_5203         CDS       T02535                                 

Definition
stearoyl-CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
gps  Glaciecola psychrophila
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:gps01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:gps01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5003962..5005098
Genome map
AA seq 378 aa AA seqDB search
MKKPRLLLTNILIFTITGLIATVLVPFEAFKNGFDAVEIISCIALIYFSGMSITAGYHRL
WSHKSYQANAFVRIVLAIGGAMSLQNSILHWCSDHRIHHKHVDDNEQDPYSAKKGFWYSH
IGWMLREYQIHRYADYNNCRDLQKDAVIIWQHKHYLKIMFAANFGVPVLLGWLNGDIWGM
LLLAGVFRLVVVHHVTFFINSLAHIWGKQPYTDKNTARDNDILAFFTFGEGYHNFHHIFE
YDYRNGIKWWQFDPTKWLIKGLSFIGWTSNLRRCPEERIEKAKAAMQLKLAQEKVSKLAN
ADEILAKVHFEYELLAQRMTDYYAAKKQLMAIKKQNLKRTYENLEVHYRYKELKQSLALQ
KQKWIHINQFDFLPVMAE
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccacgcctactgctgaccaatatcttaatatttactattaccgggcttata
gccactgtgttggtgccctttgaagcatttaaaaatggctttgatgccgttgaaattatc
tcgtgtatcgctttaatttacttttcaggcatgtcgattactgccggttaccatcgttta
tggtctcataaatcataccaagccaacgcatttgtcagaatagtattggcaataggtgga
gcaatgtcgttacaaaacagcatattgcattggtgttcagatcatcgtatccaccacaaa
catgttgacgataacgaacaagacccatattcagccaaaaaagggttctggtattctcat
attggttggatgttaagagagtatcaaatccacagatatgctgattataataactgccgc
gatcttcagaaagatgcggtaataatatggcagcataaacactatttaaaaatcatgttt
gcggcaaacttcggcgtccctgttttgttgggttggctgaatggtgatatctggggcatg
ctgttgttagcaggtgttttccgtttagttgtagttcatcacgtcacttttttcataaat
tccctagctcatatatggggaaagcaaccttacactgataaaaatactgctcgtgataac
gatatcctcgcctttttcacttttggagagggatatcataatttccaccatatatttgaa
tatgattacagaaacggcataaagtggtggcaatttgacccaacaaaatggttaattaaa
ggtttatcctttattggctggaccagtaatcttcgtcgctgcccagaagaaaggattgaa
aaagctaaggctgccatgcaactaaaattagcccaagaaaaagtatctaaattagctaat
gcagatgagatattagccaaagtgcactttgaatacgaacttttagcccagcgcatgacc
gactattacgcggcaaaaaaacaactaatggccatcaaaaaacaaaacttgaaacgcacc
tatgagaaccttgaagttcactacagatataaagagttaaagcaaagtttagcccttcaa
aagcaaaaatggatacatatcaatcagttcgactttttgcctgtcatggccgagtaa

DBGET integrated database retrieval system