KEGG   Glaciecola psychrophila: C427_5574Help
Entry
C427_5574         CDS       T02535                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
gps  Glaciecola psychrophila
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gps01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gps00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5350574..5351668)
Genome map
AA seq 364 aa AA seqDB search
MFKVNWKRAVIKVGSSLIAPNNQCSQVYLRPIAQFISDSRKQGKEVILVSSGSVAAGKGK
IAFKHHPSIVEKQAMAAIGQTQMMANWASLFDFDCAQILLTSDDLHNRTRYVNIKNTLRE
LLKNNALPIVNENDTVAINELKVGDNDNLAAYTALVAEADTLIICSDINGLYDADPRSNT
HAKLIPEVDVIDDSVYRLAGGAGSTMGTGGMHTKLQAAQKCVDSGIQTLIVNGRDPTVFE
ELAKGNSPGTLFNPNKSLDNARDNWLRHTLKVKGSIEIDDGAQHALLENGASLLPSGIIE
VNGRFLSGEAVNIIYKDNAIAKGIVLYSATDLTSIKGLNSQKIEATLGYSLGETVIHRDD
LVLL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaggttaattggaaacgagcagtgattaaagtgggtagcagcctaattgcgcca
aataatcaatgtagtcaggtgtacctaaggcctattgcccaatttattagcgatagtcgt
aaacaaggaaaagaagtgattttggtttcttcaggcagtgttgccgctggaaagggtaaa
atagcgtttaaacaccatccctcaattgtagaaaaacaagccatggcagcgattggacaa
acacaaatgatggcaaattgggcaagcttatttgatttcgattgcgcacagatattgcta
acgtctgatgatttacataatcgtacccgttacgtcaatattaaaaataccctgcgagaa
ttgctaaaaaataacgcgttacccatcgttaacgaaaatgacacagtggcaattaacgag
ctaaaagtgggcgacaatgataatctggcagcctataccgcgcttgtggcagaagcagat
accctgattatttgttctgatattaacggcttatatgacgctgaccctagaagcaatacg
catgctaagttaatacctgaagtggatgttattgatgacagcgtttaccgtttagctggt
ggtgcgggcagtaccatgggcacgggtggtatgcatactaaacttcaagcagcacaaaaa
tgtgtggattcagggatccagactttgattgtaaatggccgtgacccaacagtattcgaa
gaattggcgaaaggaaattctccaggtaccttattcaatcccaataagagtttagataac
gctcgtgacaactggttaagacacactttaaaagtgaaagggtctatcgaaattgacgac
ggagctcaacacgctttattagaaaatggcgcatccctattaccctctggtattatagag
gtcaatggacggtttttgtctggtgaagcggttaatattatctacaaggacaacgctatt
gccaaaggtattgttttgtatagcgcaacggacttaacatcaatcaagggtttaaacagc
caaaaaatcgaagccactttaggctactctttgggtgaaacagtcatccatcgtgatgac
ttagtgctgctataa

DBGET integrated database retrieval system