KEGG   Gossypium raimondii: 105788605Help
Entry
105788605         CDS       T04129                                 

Definition
(RefSeq) beta-fructofuranosidase, soluble isoenzyme I-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
gra  Gossypium raimondii
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gra00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    105788605
   00500 Starch and sucrose metabolism
    105788605
Enzymes [BR:gra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     105788605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
3
AA seq 618 aa AA seqDB search
MEASYDPEQNPPLHAPLLDRSSPRTRRFAAIFACLVSLLLLLALILNQAQQPFEKVQPRG
VGEGVSAKSNPSLLNQVPFNWTNAMFSWQRSAYHFQPQKNWMNDPNGPLYHKGWYHLFYQ
YNPYSAIWGNITWGHAVSRDLIHWLYLPLALVPDHWYDIKGVWTGSATILPDGQIIMLYT
GETNESVQVQNLAYPANVSDPLLLHWLKYPGNPVMVPPPGVKPDDFRDPTTAWLGPDGTW
RLTMGSKFDTTIGISLVYHTTNFRDYELLDGVLHAVPGTGMWECVDFYPVAINGSVALDT
SSLGPGIKHVLKASLDNTKVDHYAIGTYDPITDKWTPDNPEEDVGIGLKVDYGRYYASKT
FFDQHKQRRVLWGWINETDTETADLKKGWASLQTIPRTVLYDNKTGTNLLQWPVEEVESL
RLNSTMFKEVLVEPGSVVPLDIGTTTQLDILAEFEIEPLIPSTTNEIDDCGDGAVDRSTY
GPFGLLVIADASLSELTPIYFRPLNASDGSLKTYFCTDETRSSKASDVFKQVYGGKVPVL
DDENYNMRVLVDHSIVESFAQGGRTVISSRIYPTEAIYGAARLFLFNNATGVNVKATLKI
WELNSAFIRPFPFERDSV
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggaggcctcctacgaccccgaacaaaacccaccactccatgctcccttgctagaccgg
tcctcaccccggactagacgttttgcagccatctttgcctgcctcgtttccttgctcttg
ctcctggcattaatccttaaccaagcccaacaaccgtttgagaaagtgcagccaagaggg
gtgggtgaaggtgtgtcagccaagtcaaatccatctttattgaaccaagttccctttaat
tggactaacgctatgttttcttggcaaagaagtgcttaccattttcagccccaaaagaat
tggatgaatgatcctaacggtccattgtatcataagggatggtaccatcttttctaccaa
tacaacccttattcagctatatggggtaacatcacatggggtcatgccgtatcgagggat
ctcattcattggctctatcttccactagccctggtcccagatcactggtacgatatcaaa
ggtgtatggacggggtctgctactatcttgccagatggtcaaatcataatgctttacact
ggcgaaaccaacgagtctgtgcaggtacaaaatcttgcatatcctgccaacgtgtctgat
cccctcctccttcactggttaaaatacccgggcaaccctgttatggttcccccacccggt
gttaaacccgatgatttccgggacccaacaacagcttggcttggacccgatggtacctgg
cgtctcaccatgggctcaaagtttgataccaccattggaatctccctcgtttatcatacc
acaaactttagggattatgaactattagatggggttttacatgcggttccgggtacgggt
atgtgggaatgcgtggatttctatcctgttgcaataaacggctcggtggcgttggacacg
tcctcactcgggcctggaattaagcatgtgttaaaggctagcttggataatacaaaggtt
gaccattatgccatcggcacttatgacccaataacggataaatggacacccgataacccg
gaagaggatgtgggtatcgggttgaaagtggattacggaagatactatgcctcaaagaca
tttttcgatcagcataaacaaaggagggttctttggggttggattaatgaaactgatact
gaaactgctgacctcaaaaaaggttgggcttcccttcagacaattcccaggactgttcta
tatgacaacaagactggaaccaatttacttcaatggccagtggaagaagtagagagcttg
agattgaacagtacaatgtttaaggaggtgctagttgaacctggatctgttgtgcccctt
gacataggcaccaccactcagttggatatactagcagagtttgaaatagagccattgata
cctagtactacgaatgaaatcgatgattgcggtgatggtgcagttgataggagcacttac
ggaccatttggcctcctggttattgctgatgcttcactttcggagctgactcccatatat
ttccgtcctctcaatgcatctgatggtagtctcaagacttacttttgtaccgacgaaaca
aggtcttctaaagcttccgatgtcttcaaacaagtatatggaggcaaagttcctgtgctt
gatgatgagaactacaatatgagggtattggtggatcattcaattgtggaaagctttgct
caaggagggaggacagtgatatcatcaagaatttatccgacggaagccatctatggagca
gccaggttgttcttgttcaacaatgcaactggagtaaatgtgaaggccacactcaaaata
tgggaattgaattctgcctttattcgtcctttccccttcgaaagagatagtgtatag

DBGET integrated database retrieval system