KEGG   Geobacter sulfurreducens KN400: KN400_0013Help
Entry
KN400_0013        CDS       T01940                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gsk00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(20295..21704)
Genome map
AA seq 469 aa AA seqDB search
MKKAIVAGGGISGLATAYLLKTRAAEEGLELDVTLVEREERLGGKIWSIKEEGYLCEWGP
NGFLDSKPQTLDLCRELGASDLLLRSNDNARKRFIYTGGALNRLPENGPMFLKSGLISWP
GKLRLAMEPFIPKKAGDEDETLAAFGRRRLGDEALRKLIAPMVSGIFAGNPETMSLRSCF
PRIAELEDEYGSLVRAMIRLAKKKKQEVAQGKAVASAAGPGGVLTSFRDGIQALTDILAE
RLGPDTIVSGQEVLEVSRGGSLPWRVRTGSIDMDADLVILATPAYATASIIQGVDSDMAG
ILRQIPYATMTVVCFGYDRERIAHDLNGFGYLIPKEEGMNTLGTLWDSSIFENRAPEGQV
LLRSMMGGACFPEYVNLTDEEVTGRVKNDLATIMGITAPPSFVRIFRHHQAIPQYTVGHS
TRVAALEQRAASLPGLFLTGNSYRGIGLNDCVAAANRTAGEAIAQVTSR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggcgattgtggccggcggcggcatctcagggctcgccaccgcgtacctgctg
aaaacccgggccgcggaggaaggacttgagctcgacgtgaccctggtggagcgggaggaa
cgcctggggggcaaaatctggagcatcaaggaggaggggtatctctgcgagtggggcccc
aacggttttctggactccaaaccccagaccctcgacctctgccgggaactgggcgcgtct
gacctgctcctgcggagcaacgacaacgcccgcaagcggttcatctacaccggcggggcg
ctgaaccgcctacccgagaacggacccatgtttctcaaaagcggtctcatctcctggccg
ggcaagctgcggctcgccatggaaccgttcattccgaaaaaagcgggcgacgaggacgaa
accctggcggccttcggccggcgccgcctgggggacgaagcgctgcgcaagctgattgcg
cccatggtgtcggggatttttgccggcaatccggaaaccatgtccctgcggtcgtgcttt
ccccgcatcgccgagttggaggatgaatacggcagcttggtgcgggccatgatccgtctg
gcgaaaaagaagaagcaggaggtcgctcaaggaaaggcggtggccagcgccgccggaccg
ggcggggtgctcacctcgttccgggacggcatccaggccctcaccgatatcctggccgag
cgtctcggtccggacactatcgtatcgggccaggaagtgctggaagtttcgcggggcgga
agcctcccctggcgggtgcggaccggaagcatcgatatggacgccgatctggtgatcctg
gcgacccccgcctatgccaccgcctccatcattcagggagtggactccgacatggccggc
attctccggcagatcccctacgccaccatgaccgttgtctgcttcggatatgaccgggag
cggatcgcccacgatctgaacggcttcggctatctcattccaaaggaggaggggatgaat
accctgggcacgctctgggattcgagcatcttcgagaaccgggcgccggaaggtcaggtc
ctcctgcgcagcatgatggggggggcctgcttccccgaatacgtcaacctgaccgacgag
gaggtcactgggcgggtgaagaacgacctcgccaccatcatgggcatcacggcgcctcct
tcgttcgtccgcatcttccgccatcaccaggccatcccccagtacaccgtggggcactcc
acacgcgtagccgctctggagcagagagccgcctccctgccgggacttttcctcaccggc
aactcttaccggggtatcggcctcaacgactgcgtggccgccgccaaccgcaccgccggc
gaggccatcgcccaggtcacatcccgctga

DBGET integrated database retrieval system