KEGG   Geobacter sulfurreducens KN400: KN400_0072Help
Entry
KN400_0072        CDS       T01940                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gsk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77276..77869
Genome map
AA seq 197 aa AA seqDB search
MVHFSDSLSRLLAELQKLPGVGEKTALRLAFHLLKSPDNAAALADSLRDVMSRVRFCSVC
FGITEDDPCRFCSDARDDGAICVVEEPQDLLAVERTRAFRGRYHVLQGALSPLNGVTPDR
LRVAELMKRLEGGGVREVVIATNFTVEGEATALYLARMIKPLGVRVTRLAHGIPLGSDLE
FVDAATVQRALEGRSEL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggtacatttttcagactcattgtcacggttgctcgcggaactgcaaaagctgccggga
gttggcgagaaaaccgccctgcgcctcgcctttcatcttttgaaatcccccgacaacgcc
gctgccctggctgacagtcttcgggacgtcatgtcccgggtgcggttctgttccgtctgt
ttcggcattaccgaggacgatccctgccggttttgctccgatgcccgagatgacggtgcc
atctgcgtcgtcgaggaaccccaggaccttctggccgttgagcggacccgagccttcagg
gggcgttatcatgtgctccagggggcgctgtccccgctcaacggtgttacccccgaccgg
ctccgcgttgcggagctcatgaagcggctggaggggggaggggttcgggaagtggttatt
gccaccaacttcaccgtggagggcgaagcaaccgcgctctatctggccaggatgatcaag
cccctgggggtcagggtgacacgactcgcccacgggataccgctcggcagcgatctggag
ttcgtggatgcggccacggtgcagcgggcgctggaaggacggagcgagctgtaa

DBGET integrated database retrieval system