KEGG   Geobacter sulfurreducens KN400: KN400_0111Help
Entry
KN400_0111        CDS       T01940                                 

Gene name
hemB
Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KN400_0111 (hemB)
Enzymes [BR:gsk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     KN400_0111 (hemB)
Exosome [BR:gsk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KN400_0111 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(118036..119013)
Genome map
AA seq 325 aa AA seqDB search
MFYPTFRARRIRGKEVFRRMVSETTLSATDLIYPMFSAFGTGIRKEISSMPGIYQQSIEH
IVAEAQEVHELGVPAVILFGIPETKDAVGSDAYAEHGIIQETIRALKKQVPGLAVITDVC
MCEYTDHGHCGIIKDGDVDNDETLELLAREALSHAEAGADMVAPSDMMDGRVMAIREILD
NNGYKNIPIMSYAVKYASGYYGPFREAAESTPQFGDRRSYQMDPGNRREAIREARMDVEE
GADIIMVKPGLPYLDIVRDLREEFDLPVAVYNVSGEYSMIKAAGRAGWIDEERVMMETLL
SFKRAGADLILTYHAKEAARVLKRG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgttctatcccaccttcagagcacgcaggatcagaggcaaggaggtctttcgccggatg
gtcagcgagaccaccctttccgccaccgacctgatctatccgatgttttccgccttcggc
acgggcatcaggaaggaaatctcttccatgccggggatttatcaacaatccatcgagcac
atcgtggccgaggcccaggaggtccatgagctgggcgtgccggcggtgatcctgttcggc
atccccgagaccaaggacgccgtgggcagcgacgcctacgccgagcacggcatcattcag
gagacgatccgggccctgaagaaacaggtgccggggctggcagtcattaccgacgtctgc
atgtgcgaatacaccgaccacggtcactgcggcatcatcaaggacggcgacgtggacaac
gacgagaccctggagctcctggccagagaggccctctcccacgccgaggccggggccgac
atggtggctccttcggacatgatggacggacgagtcatggcgatccgcgaaattctggac
aacaacggctacaagaacatcccgatcatgagctatgccgtaaaatacgcctccggttac
tacggcccgttccgggaggcggccgagtcgaccccccagttcggcgaccgccgctcctac
cagatggacccggggaaccgccgggaggccatccgcgaagcccgcatggacgtggaagaa
ggcgccgacatcatcatggtgaagccggggcttccctacctcgacatcgtccgggacctg
cgggaggaattcgatctccccgtggcggtctacaacgtctccggcgagtacagcatgatc
aaggccgccggccgggccggctggatcgacgaagagcgggtcatgatggagaccctcctc
tccttcaagcgggccggcgctgacctgatcctcacttaccacgccaaggaggctgcgcgg
gtcctcaagagaggatag

DBGET integrated database retrieval system