KEGG   Geobacter sulfurreducens KN400: KN400_0452Help
Entry
KN400_0452        CDS       T01940                                 

Gene name
macA
Definition
cytochrome c peroxidase, 2 heme-binding sites
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
gsk  Geobacter sulfurreducens KN400
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(483560..484600)
Genome map
AA seq 346 aa AA seqDB search
MKTRNLAWGMALTLVAGVAWGKEDVMKRAQGLFKPIPAKPPVMKDNPASPSRVELGRMLF
FDPRLSASHLISCNTCHNVGLGGTDILETSIGHGWQKGPRNSPTVLNAVYNIAQFWDGRA
EDLAAQAKGPVQASVEMNNKPENLVATLKSIPGYPPLFRKAFPGQGDPVTFDNVAKAIEV
FEATLVTPDAPFDKYLKGNRKAISSTAEQGLALFLDKGCAACHSGVNMGGTGYFPFGVRE
DPGPVVRPVDDTGRYKVTSTAADKYVFRSPSLRNVAITMPYFHSGKVWKLKDAVKIMGSA
QLGISITDADADKIVTFLNTLTGAQPKVMHPVLPPNSDDTPRPVSN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgaaatctcgcatggggaatggccctcaccctggtagcgggcgtcgcctgg
gggaaagaggatgtcatgaaacgtgcgcaggggctcttcaagccgatccctgccaagccg
ccggtcatgaaggacaatccggccagtccgtccagggtcgagctggggaggatgctgttc
ttcgatccgcggctttcggcttcgcacttaatcagctgtaacacctgtcacaacgtaggc
ctgggcggcaccgacatcctggagacatccatcggtcacggctggcaaaaggggccacgc
aactcccccactgtgctcaatgccgtctacaacatcgcccagttctgggacggccgtgcc
gaggacctggcagcccaggccaaggggccggttcaggcatcggtggagatgaacaacaag
cccgaaaacctggtcgccaccctcaagagcattcccggttaccctccccttttccgcaag
gccttccccgggcagggtgatccggtaaccttcgacaacgtggccaaggccatcgaggtc
ttcgaggccacgctcgtcacccccgatgcccccttcgacaaatacctgaagggcaaccgc
aaggccatcagcagcacagcggaacaggggctcgccctcttcctggacaaaggatgcgcg
gcctgccacagcggcgtcaacatgggcggaaccggctacttccccttcggcgtccgtgaa
gatccggggccggtggtgagacccgtggacgacaccggccgttacaaggtgaccagcacg
gccgcggacaaatacgtgttccgttcgccgagcctgcgcaacgtggccatcaccatgccc
tacttccactcgggcaaggtctggaaactgaaggacgccgtcaagatcatggggagcgct
caactcggcatctccatcaccgacgccgacgctgacaagattgtcacgttcctcaacacc
ctcaccggcgcgcagccgaaggtgatgcaccctgtcctgccgcccaactcggacgatacc
cccaggccggtcagcaactga

DBGET integrated database retrieval system