KEGG   Geobacter sulfurreducens KN400: KN400_0829Help
Entry
KN400_0829        CDS       T01940                                 

Definition
protein disulfide bond isomerase, DsbC/DsbG-like
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
gsk  Geobacter sulfurreducens KN400
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
886195..887001
Genome map
AA seq 268 aa AA seqDB search
MTKRLINSCLVGALVAVLAAGSALASPKEGAKEESPEATIKALFPTLPLTSVKKTPIDGL
FEVITDGNVIYIYPKTGNVIIGNLFTKEGKNLTAEASNRLVADRYKLITAADKEKAVKVG
NGKYEVIEITDPDCPYCRKMHEYWGRRPDVTRYVFFLPLAMHPDAEKKIRYILSAENKEL
AFWEVYSGELDNKREILDAPRDDKGLLAAHKAIVAKLGVNSTPTFWVQGTYVNGANTQLI
EKVIGTCKTAEGMAPGAPVKCEDEGQKK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaacgactgatcaactcctgtctggtcggggcgctggttgccgtactggcagca
ggctcagccctcgcttccccgaaggagggggccaaagaggagagccccgaagcgacgatc
aaggcgctcttcccaacgctgcctctgacaagcgttaagaaaaccccaatcgacggcctc
ttcgaggtgattaccgacggcaacgtcatctacatctatccgaagaccggcaacgtcatc
atcggcaatctcttcaccaaggagggcaagaacctgacggcagaggcgagcaaccgcctg
gtagcggatcgctacaagctcatcaccgccgccgacaaggagaaagcggtgaaagtcggc
aacggcaagtacgaggtcatcgagatcaccgaccccgattgcccctattgccgcaagatg
cacgagtactggggccgcaggcccgacgtgacccgttacgtcttcttccttccccttgcc
atgcatcccgatgccgagaagaagatccgctacatcctgtccgccgagaacaaggaactg
gccttctgggaagtctattcgggcgagttggacaacaagcgtgagatccttgacgccccc
cgggacgacaaggggcttctcgccgcccacaaggcgatcgtggccaagctgggcgtgaac
tctactcccaccttctgggtgcagggaacctatgtgaacggcgccaatacccagctcatc
gagaaggtgatcggcacgtgcaagaccgccgagggcatggctcccggtgctcctgtcaag
tgcgaggacgaggggcagaagaaatag

DBGET integrated database retrieval system