KEGG   Geobacter sulfurreducens KN400: KN400_0840Help
Entry
KN400_0840        CDS       T01940                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KN400_0840 (galU)
   00052 Galactose metabolism
    KN400_0840 (galU)
   00500 Starch and sucrose metabolism
    KN400_0840 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    KN400_0840 (galU)
Enzymes [BR:gsk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KN400_0840 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(894682..895551)
Genome map
AA seq 289 aa AA seqDB search
MQVKKAVFPVAGLGTRFLPATKSSPKEMLPLIDKPLVQYVVEEAVASGIEQLLFVTGRSK
RAIEDHFDISFELEALLQEKGKDDMLQEVREIADMVKIFYVRQKQALGLGHAILCAREFV
GDEPFAVLLGDDIIDAEQPCLGQLLDVYRKYRGPVVALEKVPIEAISSYGCVKATGITDR
IFEVTDLVEKPRREEAPSDMAIIGRYVLTPDIFPILERQTPGKGGEIQLTDALLTLSREE
AIYGCLFKGKRHDCGDKLGFLKATVDMALKREEFNEEFRDYLREVLARG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtaaaaaaagcggtattcccggtggcgggactcggtacccggtttcttccggca
accaaatcatctcccaaggagatgctccccctgatcgacaagccgctggtccaatacgtg
gtggaggaggcggttgcctcgggcatcgagcagctcctctttgtgaccggtcggagcaag
cgggccattgaggatcacttcgacatctccttcgagctggaagcgctgctccaggaaaag
gggaaggatgacatgctccaggaggtgcgggagattgccgacatggtgaagattttctat
gtccggcagaaacaggccctgggactcggccacgccatcctctgcgccagggaattcgtg
ggcgacgaacccttcgcggtcctgctgggggacgacatcatcgacgcggaacaaccctgc
ctgggccagctcctggatgtctaccgtaaataccggggtccggtcgtggccctggaaaag
gtgcccatcgaggccatctcctcctacggctgcgtgaaggcaacgggaataaccgaccgg
atcttcgaggtgactgacctggtggaaaaacctcgccgcgaggaggccccttcggacatg
gccatcatcggtcgttacgtccttacccccgacatctttcccatcctggaacgccagacc
cccggcaaggggggtgaaatccagctcaccgacgccctgctcaccctgtcgcgggaagag
gccatttacggctgcctgttcaagggaaagcgccacgactgcggcgacaagctcggcttc
ctgaaagccacggtggacatggccctcaaacgggaggagttcaacgaagagttccgggac
tatctgcgggaagtgctggccaggggctga

DBGET integrated database retrieval system