KEGG   Geobacter sulfurreducens KN400: KN400_0840Help
Entry
KN400_0840        CDS       T01940                                 

Gene name
galU
Definition
(GenBank) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk00040  Pentose and glucuronate interconversions
gsk00052  Galactose metabolism
gsk00500  Starch and sucrose metabolism
gsk00520  Amino sugar and nucleotide sugar metabolism
gsk01100  Metabolic pathways
gsk01130  Biosynthesis of antibiotics
Module
gsk_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KN400_0840 (galU)
   00052 Galactose metabolism
    KN400_0840 (galU)
   00500 Starch and sucrose metabolism
    KN400_0840 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    KN400_0840 (galU)
Enzymes [BR:gsk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KN400_0840 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: ADI83703
Position
complement(894682..895551)
Genome map
AA seq 289 aa AA seqDB search
MQVKKAVFPVAGLGTRFLPATKSSPKEMLPLIDKPLVQYVVEEAVASGIEQLLFVTGRSK
RAIEDHFDISFELEALLQEKGKDDMLQEVREIADMVKIFYVRQKQALGLGHAILCAREFV
GDEPFAVLLGDDIIDAEQPCLGQLLDVYRKYRGPVVALEKVPIEAISSYGCVKATGITDR
IFEVTDLVEKPRREEAPSDMAIIGRYVLTPDIFPILERQTPGKGGEIQLTDALLTLSREE
AIYGCLFKGKRHDCGDKLGFLKATVDMALKREEFNEEFRDYLREVLARG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtaaaaaaagcggtattcccggtggcgggactcggtacccggtttcttccggca
accaaatcatctcccaaggagatgctccccctgatcgacaagccgctggtccaatacgtg
gtggaggaggcggttgcctcgggcatcgagcagctcctctttgtgaccggtcggagcaag
cgggccattgaggatcacttcgacatctccttcgagctggaagcgctgctccaggaaaag
gggaaggatgacatgctccaggaggtgcgggagattgccgacatggtgaagattttctat
gtccggcagaaacaggccctgggactcggccacgccatcctctgcgccagggaattcgtg
ggcgacgaacccttcgcggtcctgctgggggacgacatcatcgacgcggaacaaccctgc
ctgggccagctcctggatgtctaccgtaaataccggggtccggtcgtggccctggaaaag
gtgcccatcgaggccatctcctcctacggctgcgtgaaggcaacgggaataaccgaccgg
atcttcgaggtgactgacctggtggaaaaacctcgccgcgaggaggccccttcggacatg
gccatcatcggtcgttacgtccttacccccgacatctttcccatcctggaacgccagacc
cccggcaaggggggtgaaatccagctcaccgacgccctgctcaccctgtcgcgggaagag
gccatttacggctgcctgttcaagggaaagcgccacgactgcggcgacaagctcggcttc
ctgaaagccacggtggacatggccctcaaacgggaggagttcaacgaagagttccgggac
tatctgcgggaagtgctggccaggggctga

DBGET integrated database retrieval system