KEGG   Geobacter sulfurreducens KN400: KN400_1159Help
Entry
KN400_1159        CDS       T01940                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KN400_1159 (malQ)
Enzymes [BR:gsk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     KN400_1159 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1259607..1261088
Genome map
AA seq 493 aa AA seqDB search
MRQKRRSGILLHPTSLPGPGGIGSLGKECRHFIDFLEEAGQSLWQVLPLGPAAYGNSPYS
CYSAFAGNPLLIDLATLVDEGDLEPEEAVAEVSADHVDFPAVDAFKSRALRTAAARFHAH
GDTDRKQEFWHFCDTTPWLHDAALFMALKEHFGGKSWNTWPKEIARRESSALEKYSVRLG
VAIGEHKYIQWQFSRQWRHVREYANSKGIAVVGDIPIFVAFDSTDVWTNPGLFKLDDKGK
PTVVAGVPPDYFSKTGQRWGNPLYDWDAMAADGFRWWIERFRGSFALHDVVRVDHFRGFE
ACWEVPAKEKTAVNGQWVPAPGTALFDAVIGAVGSLPIIAEDLGVITPAVEELRDRYRFP
GMKILQFAFDSGPGNPYLPHNFTRDCVVYTGTHDNDTTQGWFQSLSPRERREVLAYTDTT
GKEVHWELIRLGMASVADMAIFPLQDVMGLDGSSRMNLPGTPRGNWSWRYSEGMLTAKHA
KKLLELTVLFGRK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagacagaaacgtcgcagcggcatccttctccatccgacttccctgccgggtccgggg
gggatcggatcgctcgggaaagagtgccgccatttcatcgatttcctcgaagaggcgggg
cagagcctctggcaggttcttccgctggggcccgcagcctacggcaattccccctattcc
tgctattcggcttttgctggcaaccccctgctgatcgacctggcgaccctcgtggatgag
ggggacctggagcccgaggaggctgtggcggaggtgtctgccgatcatgtggactttccg
gctgtggatgcgttcaagtcacgcgcgctccggaccgctgcggcccggttccacgcccac
ggtgacacggatcgtaaacaggagttctggcacttttgcgatactaccccctggcttcac
gacgctgcgctgttcatggctctcaaggagcatttcggcggcaaaagctggaatacctgg
cccaaggagattgcccgccgggagtcgtccgcgctcgaaaagtattcggttcggctgggc
gtggccattggcgaacacaagtatatccagtggcagttttcccgtcagtggcgacatgtc
agggaatatgccaacagcaaggggattgcggttgtcggcgatatccccatctttgtggct
ttcgattcaaccgatgtctggacgaatccgggccttttcaagctcgacgacaagggcaag
cccaccgtggtagccggggtcccgccggactatttcagcaagacaggccagcgatggggg
aaccctctctatgactgggatgccatggccgccgatggatttcgctggtggatcgagcgg
ttccgcggttcgttcgcgctccatgatgtggtcagggtcgatcacttccgagggttcgag
gcgtgctgggaggttccggccaaagaaaagacggcggtgaacggccaatgggtccccgct
ccggggacggcactctttgatgccgttatcggggcggtggggtcactgccgatcattgcc
gaggacctgggagtcattaccccggccgtggaggaactgcgcgaccggtaccgtttcccc
ggcatgaagatcctccagttcgcctttgattccggcccgggcaatccctacctgccccac
aacttcacccgtgactgcgtggtctacaccggcacccacgacaatgataccacccagggc
tggtttcaaagcctttccccccgggagcgacgagaagttctggcctataccgacaccacg
ggtaaggaggtccattgggagctgatccgtctcggcatggcctcggtggccgatatggcg
attttcccgcttcaggatgtcatgggacttgatgggtcaagccggatgaatctccccgga
acaccgcgcgggaactggtcgtggcgttatagtgagggtatgcttactgctaagcacgca
aaaaagcttctcgaattaaccgtgctttttgggagaaaatag

DBGET integrated database retrieval system