KEGG   Geobacter sulfurreducens KN400: KN400_1548Help
Entry
KN400_1548        CDS       T01940                                 

Gene name
pcm
Definition
protein L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
gsk  Geobacter sulfurreducens KN400
Brite
Enzymes [BR:gsk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     KN400_1548 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1640232..1640882
Genome map
AA seq 216 aa AA seqDB search
MNFEIARKRMVESQIIARGVSDRRVIEAMLKVPRHVFVEEAMAAQAYSDTPLPIGEKQTI
SQPYMVALMTELLELKGKEKVLEIGTGSGYQAAILAVMADRVYTVERIRPLALRARKALD
SLGLLNVNIKMSDGTVGWEDEAPFDAIIVTAGAPDIPQQYIDQLKPGGRLVIPVGTQFEQ
VLVRVVKQEDGSVERENITGCRFVKLVGKFGWSSDD
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaattgcacgcaaacggatggtcgaatcccagatcatcgcgcgaggcgtc
tcggaccggcgggtgatcgaggcgatgctgaaagtgccccgccacgtctttgtagaagag
gccatggccgcccaggcctacagcgacacaccgctgcccatcggcgaaaaacagaccatc
tcccagccttacatggtcgccctgatgaccgaactcctggagttgaaagggaaggaaaag
gttctggaaatcggtaccggctcagggtaccaggccgctatcctggcagtcatggccgac
cgggtctacacggtggagcgcattcgtccgcttgcgttgcgggcgcgcaaggccctcgac
agcctgggcctactcaatgtcaatatcaagatgtccgacggcacggttggctgggaagac
gaggctcccttcgacgccatcattgtgaccgccggagccccggatatcccgcaacagtac
atcgaccagctcaagcccggcgggaggcttgtcatcccggtggggacccagttcgaacag
gtgctcgtcagggtggtcaagcaggaggacggttcggtcgagcgggagaacatcacggga
tgcaggttcgtcaaactggtgggcaaattcggttggagcagcgatgactaa

DBGET integrated database retrieval system