KEGG   Geobacter sulfurreducens KN400: KN400_1560Help
Entry
KN400_1560        CDS       T01940                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    KN400_1560 (recD)
Enzymes [BR:gsk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     KN400_1560 (recD)
DNA repair and recombination proteins [BR:gsk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     KN400_1560 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 Helicase_RecD AAA_11 UvrD-helicase DUF2075 AAA_16 UvrD_C AAA_22 PhoH ArgK AAA_29 AAA_28
Motif
Other DBs
NCBI-ProteinID: ADI84372
Position
1656699..1658486
Genome map
AA seq 595 aa AA seqDB search
MSADDLQFRDIDACFADFLCRLAGGRNDDLHRAAMHASAAVGAGHVCLHLDEAFGSNGAA
LAVTLRALPVVGPPGGRTPLILDEKNRLYLYRYWNYEYLVAEFIKQKSAELRPVSLPLLR
AGIDRIFGPKGDDAVDWQRVAAAAAVRSGFCVISGGPGTGKTSTVVSILALLLEQAGEEG
AGIALAAPTGKAAARLGDSIRDARQRLAAVTPVAERIPGQVSTIHRLLGVIPGSVRFRHD
RHNPLPHRVVVVDEASMVPLPLMARLVEALAPSARLILLGDRDQLASVEAGAVLGDICDT
GRAHRFSAPFREFIRDAASEEIEGEAGDDGNDQPGTPADSLVILRRNYRFGAASAIGAAS
AAVNEGDGDRLMALVSGEGMDGGVALRPVPPAERLAGALAESVVAGYGEYLGQADPEQAL
ACFDRFRVLCAVRQGEYGVQGLNRAIERVLARQGLIDADRVWYPGRPVMVTVNDYGLGLF
NGDIGLAVADPAFSGGLAVCFPAPGGGVRKISPARLPAHETVFAMTVHKSQGSEFDRILL
VLPPFDSPVLTRELVYTGLTRARTGAVIWADEEILRSAAARRSERRSGLREALWG
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgccgacgacctgcaattccgcgacatcgacgcctgttttgccgacttcctctgc
cgcctggccgggggccggaacgacgatctccatcgggccgccatgcacgccagcgccgcc
gtaggggccggccacgtctgcctgcacctggacgaggcctttggcagcaatggagcggcc
ctggccgtcaccctcagggccctgccggtggtgggcccgcccggtggccgcacccccctg
atccttgacgaaaagaaccgcctctacctttatcgatactggaactatgaatatctagtt
gctgaattcataaagcaaaaatccgcagagctccgtcccgtttccctgccgctcctgcgg
gcgggtattgaccggatcttcgggccgaagggggacgatgccgtggactggcagcgggtg
gctgccgcggccgcggtgcggagcggcttttgcgtcatctccggggggccgggtaccggc
aagacctccaccgtggtttcgatcctggccctgctcctggagcaggccggcgaggagggg
gcgggcattgccctggcagcgcccacgggaaaggccgcggcgcggctcggcgactccatc
cgcgacgcccgtcagcgcctggcagcggtgacccccgtggcggaacggattcccggccag
gtctccaccatccaccggctgctgggggtgattcccggctcggtccgtttccgtcatgac
cggcacaatccgctgccccaccgggtagtggtggtggacgaggcctccatggtgccgctg
cctctcatggcccggctggtggaggccctggcgccgtcggctcggctcatcctcctgggg
gaccgggaccagctcgcctcggtggaggccggggccgtgctgggcgacatctgcgacacc
gggcgggcgcaccggttctcggccccgttccgggagttcatccgtgatgccgcgagtgag
gagatcgagggagaagccggggacgacgggaacgaccagccgggtacgccggccgactcc
ctggtgatcctgcgcaggaactaccgcttcggtgcggccagcgccattggcgcggccagt
gcggccgtgaacgagggcgacggggaccggctcatggcgcttgtgtcaggagaagggatg
gacggaggcgtggcgctccggcccgtgccgccggcggagcggcttgccggggccctggct
gagagcgttgttgcggggtacggcgagtatctggggcaggcggacccggaacaggccctg
gcctgcttcgaccgcttccgggtcctttgtgccgttcggcagggggagtacggggtgcag
gggctcaaccgggccatcgagcgggtcctggcacggcaggggctcatcgatgccgaccgc
gtctggtatccggggcggccggtcatggtgacggtgaacgactacgggctggggcttttc
aacggcgacatcggcctggcggttgccgatcccgccttcagcggcggcctggccgtctgc
tttcccgcaccaggcggcggagtcagaaagatttccccggcccggctgcccgcccacgaa
acggttttcgccatgacggtccacaagagccaggggtccgagttcgaccggattctgctg
gtgctcccccccttcgacagtcccgtgctcacgcgggaactggtctacacgggactcacc
cgcgcccggaccggtgcggtcatctgggcggacgaggagatcctgcggtccgctgcggcg
cggaggagcgaacggcggtcgggcctgcgggaagcgttgtggggatga

DBGET integrated database retrieval system