KEGG   Geobacter sulfurreducens KN400: KN400_1634Help
Entry
KN400_1634        CDS       T01940                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KN400_1634 (gpmA)
   01230 Biosynthesis of amino acids
    KN400_1634 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KN400_1634 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    KN400_1634 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KN400_1634 (gpmA)
Enzymes [BR:gsk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KN400_1634 (gpmA)
Exosome [BR:gsk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KN400_1634 (gpmA)
  Exosomal proteins of melanoma cells
   KN400_1634 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1735655..1736398
Genome map
AA seq 247 aa AA seqDB search
MRTLVLIRHGESVWNRENRFTGWTDVGLTDKGAAEALRAGRTLKNEGFAFDEAFTSVLKR
AIKTLWIVLEEMDQMWIPEHRHWRLNERHYGALQGLNKAETAERHGMEQVHVWRRSYDIP
PPPLAAGDPRNPARDPRYAELDPADIPLTESLKDTVARFLPYWHETIAPRILAGRRLLIA
AHGNSLRALVKYLDGIGDDAIAGLNIPTGIPLVYELEDDLHPIRSYYLGDPDEVARATQS
VADQVKR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgctcgttctgattcgtcatggggagagtgtctggaacagggaaaaccgtttt
accggctggactgacgtggggctgaccgataagggcgcggcagaggccctgcgtgccggt
cgtaccctgaaaaacgaggggtttgcctttgacgaggcgttcacctcagtgctcaagcgg
gccatcaaaaccctctggatcgttttggaggagatggatcagatgtggattccggagcac
cgtcactggcggcttaatgaacgccactacggcgcgctccagggactcaataaggccgaa
actgccgaaaggcacggcatggaacaagttcatgtctggcgccgcagctatgatattccg
ccaccgcccctggccgccggcgatccgcgcaaccctgcacgggacccgcgctatgcggag
cttgatcccgcagatatccccctgaccgagtcgctcaaggataccgtagcccgtttcctt
ccctactggcacgagacgattgcgccccgcattctcgcgggccgccgcctgctcatcgcc
gcccatggcaacagtctgcgggccctggtgaagtacctggacggcatcggggacgacgcc
attgccggtctgaatattcccaccggcattccccttgtctatgagctggaagatgacctg
caccccatacgaagctattacctgggtgatcctgacgaggttgcccgggccacccagtcg
gtggcggatcaggtaaagaggtag

DBGET integrated database retrieval system