KEGG   Geobacter sulfurreducens KN400: KN400_1634Help
Entry
KN400_1634        CDS       T01940                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk00010  Glycolysis / Gluconeogenesis
gsk00260  Glycine, serine and threonine metabolism
gsk00680  Methane metabolism
gsk01100  Metabolic pathways
gsk01110  Biosynthesis of secondary metabolites
gsk01120  Microbial metabolism in diverse environments
gsk01130  Biosynthesis of antibiotics
gsk01200  Carbon metabolism
gsk01230  Biosynthesis of amino acids
Module
gsk_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KN400_1634 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    KN400_1634 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KN400_1634 (gpmA)
Enzymes [BR:gsk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KN400_1634 (gpmA)
Membrane trafficking [BR:gsk04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    KN400_1634 (gpmA)
Exosome [BR:gsk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KN400_1634 (gpmA)
  Exosomal proteins of melanoma cells
   KN400_1634 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADI84446
Position
1735655..1736398
Genome map
AA seq 247 aa AA seqDB search
MRTLVLIRHGESVWNRENRFTGWTDVGLTDKGAAEALRAGRTLKNEGFAFDEAFTSVLKR
AIKTLWIVLEEMDQMWIPEHRHWRLNERHYGALQGLNKAETAERHGMEQVHVWRRSYDIP
PPPLAAGDPRNPARDPRYAELDPADIPLTESLKDTVARFLPYWHETIAPRILAGRRLLIA
AHGNSLRALVKYLDGIGDDAIAGLNIPTGIPLVYELEDDLHPIRSYYLGDPDEVARATQS
VADQVKR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgctcgttctgattcgtcatggggagagtgtctggaacagggaaaaccgtttt
accggctggactgacgtggggctgaccgataagggcgcggcagaggccctgcgtgccggt
cgtaccctgaaaaacgaggggtttgcctttgacgaggcgttcacctcagtgctcaagcgg
gccatcaaaaccctctggatcgttttggaggagatggatcagatgtggattccggagcac
cgtcactggcggcttaatgaacgccactacggcgcgctccagggactcaataaggccgaa
actgccgaaaggcacggcatggaacaagttcatgtctggcgccgcagctatgatattccg
ccaccgcccctggccgccggcgatccgcgcaaccctgcacgggacccgcgctatgcggag
cttgatcccgcagatatccccctgaccgagtcgctcaaggataccgtagcccgtttcctt
ccctactggcacgagacgattgcgccccgcattctcgcgggccgccgcctgctcatcgcc
gcccatggcaacagtctgcgggccctggtgaagtacctggacggcatcggggacgacgcc
attgccggtctgaatattcccaccggcattccccttgtctatgagctggaagatgacctg
caccccatacgaagctattacctgggtgatcctgacgaggttgcccgggccacccagtcg
gtggcggatcaggtaaagaggtag

DBGET integrated database retrieval system