KEGG   Geobacter sulfurreducens KN400: KN400_1650Help
Entry
KN400_1650        CDS       T01940                                 

Gene name
tpi
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KN400_1650 (tpi)
   01230 Biosynthesis of amino acids
    KN400_1650 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KN400_1650 (tpi)
   00051 Fructose and mannose metabolism
    KN400_1650 (tpi)
   00562 Inositol phosphate metabolism
    KN400_1650 (tpi)
Enzymes [BR:gsk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KN400_1650 (tpi)
Exosome [BR:gsk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KN400_1650 (tpi)
  Exosomal proteins of bladder cancer cells
   KN400_1650 (tpi)
  Exosomal proteins of melanoma cells
   KN400_1650 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1752022..1752777)
Genome map
AA seq 251 aa AA seqDB search
MRTPVIAGNWKLFKKRAEARELVNGLVSLVKDVQGVEIVVAPVFTVLAAVKGALDGSAIK
LAGQDCFWEEEGAYTGEISPGMLVDAGCSHVIIGHSERRQYFGETDETVNRKIKAALKAG
LAAIACIGESLAEREAGTTFDVLRTQLNGGLAGLSADDLKDVIIAYEPVWAIGTGKTATD
AQAQEAHAFIRGVVSELLGKPAAEAVRILYGGSVKPENIKGLMTQPDIDGALVGGASLKA
DSFAAIASFSM
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaacacctgtgattgcaggaaactggaagctgttcaaaaaacgcgccgaggcccgt
gagctggtcaatggacttgtttccctggtgaaggacgtccagggggtcgaaatcgtcgta
gctccggtcttcaccgtactggccgccgtaaagggcgccctggacggctcagccatcaag
ctcgctggccaggactgcttctgggaagaggaaggggcttacaccggcgagatttccccg
ggcatgctcgtggatgccggatgcagccacgtcattatcggccattcggagcgccgtcag
tatttcggcgaaactgatgaaaccgtgaatcgtaagatcaaggccgccctcaaagcagga
ctcgcggccattgcctgcatcggagaatccctggcagagcgcgaagcaggcacgacgttc
gacgtgctgcggacgcagctgaacggcggactggccgggctatccgccgacgacctcaaa
gacgtcatcatcgcctatgagccggtatgggccataggcaccggaaaaaccgccacggac
gcccaagcccaggaggctcacgccttcatcagaggggtggtgtccgaacttctcggcaaa
ccggcagcagaggcggttcgcatcctttacgggggcagcgtaaagccagagaacatcaag
gggctcatgacccaacccgatatcgacggcgccctggtgggaggagccagcctcaaggcg
gactcttttgcggcgattgcctcgttcagcatgtaa

DBGET integrated database retrieval system