KEGG   Geobacter sulfurreducens KN400: KN400_1717Help
Entry
KN400_1717        CDS       T01940                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KN400_1717 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KN400_1717 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KN400_1717 (thrC)
Enzymes [BR:gsk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KN400_1717 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1822704..1824089)
Genome map
AA seq 461 aa AA seqDB search
MRYISTRGTIQPIRFKDAVMMGLATDGGLLLPETIPAIDRDTLAAWKTLPFQELAFRIIS
RYADDIPADDLRSLIERSYATFDHPDVTPVVERGGLHILELFHGPTLAFKDVALQFLGNL
FEYLLQERNERMNIVGATSGDTGSAAIYGVRGKENINIFILHPHGKTSPVQALQMTTVLD
PNVHNIAVRGTFDDCQNIVKSLFNDLPFKERYALGAVNSINWARVLAQVVYYFLSYFRVA
KTIGDEVVFSVPTGNFGDIFAGYVAKRMGLPIARLLLATNENNILARFINDGDYSLSAVV
PTVSPSMDIQLASNFERYVYYLFGEDPARVREAFATLPARGRIVFSDAEMEHVRTEFLAC
SVNQQETVDTIASFNRETGYLLDPHTAVGVRAARQLVTDGTPVICLATAHPAKFADAVVR
AVGFEPPRPPSLMGIEDLPSRCEVLDARIEQIRTFIEEKAR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacatcagcaccagaggaaccattcagcccattcgcttcaaggacgcggtcatg
atggggctcgccaccgatggggggcttcttctgccggaaacaataccggccatcgaccgg
gacacgctcgcggcatggaagacgttgccgttccaggaactcgccttccggatcatctcc
cgctacgccgacgacatcccggccgatgacctgcggagtctcattgagcgctcctatgca
acctttgatcatcccgacgtgacgccggtcgtggagcggggcggcctccacatcctcgaa
ctcttccacggacccacgcttgcattcaaggacgtggctcttcagttcctgggcaacctc
ttcgaatatctgctgcaggagcggaacgaacggatgaacatcgtcggcgccacgtccggc
gacacgggaagtgccgccatttacggcgtgcgggggaaggagaacatcaacatcttcatc
ctccatccccacggcaaaacctcgccggtccaggcgctacagatgaccacggtactcgat
cccaacgtgcacaacattgccgtgcgcggcacctttgacgattgccagaacatcgtcaag
agcctgttcaacgacctccccttcaaggaacgctacgctctcggcgccgtcaactccatc
aactgggcccgggtactggcccaggtggtctattacttcctctcttacttccgcgtggca
aagaccattggcgacgaagttgtcttctcggttcccacgggcaacttcggcgatattttt
gccggctacgtggccaagcgaatgggactgcccattgccagactgctcctggccaccaac
gaaaacaacattctcgcccgcttcatcaatgacggagactattcgctgagtgccgtggtg
cccactgtgtcgccgtccatggacatccagctggcttcaaacttcgaacgctatgtctac
tatctcttcggagaagaccctgccagggtccgcgaggcattcgccacgcttcccgcccgg
ggccggatcgtcttctccgatgccgaaatggagcacgtgcgcaccgaattccttgcctgt
tcggttaaccagcaggagaccgtcgacaccatcgcctccttcaaccgtgaaaccggctac
ctccttgatccccacacggcagtgggtgtccgggctgcccggcaactggtgaccgacggc
acgccggtcatctgccttgccactgctcacccggcgaagttcgccgatgccgtggtgcgc
gcagtagggttcgaaccgccgcgtcctccatcgctcatgggaattgaagacctgccgagc
cggtgcgaggtgcttgacgcacgtatcgagcagatcaggaccttcatcgaggagaaggcc
cgctaa

DBGET integrated database retrieval system