KEGG   Geobacter sulfurreducens KN400: KN400_1727Help
Entry
KN400_1727        CDS       T01940                                 

Gene name
pfk-1
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk00010  Glycolysis / Gluconeogenesis
gsk00030  Pentose phosphate pathway
gsk00051  Fructose and mannose metabolism
gsk00052  Galactose metabolism
gsk00680  Methane metabolism
gsk01100  Metabolic pathways
gsk01110  Biosynthesis of secondary metabolites
gsk01120  Microbial metabolism in diverse environments
gsk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KN400_1727 (pfk-1)
   00030 Pentose phosphate pathway
    KN400_1727 (pfk-1)
   00051 Fructose and mannose metabolism
    KN400_1727 (pfk-1)
   00052 Galactose metabolism
    KN400_1727 (pfk-1)
  Energy metabolism
   00680 Methane metabolism
    KN400_1727 (pfk-1)
Enzymes [BR:gsk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KN400_1727 (pfk-1)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     KN400_1727 (pfk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat UPF0261 Fve Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ADI84539
Position
1834847..1835938
Genome map
AA seq 363 aa AA seqDB search
MARKVGILTGGGDCPGLNAVIRGVVKSSIIRRGWEVVGIRDGFDGLLYNNRIVPLGLNEV
RGILPRGGTILGTSNRGNPFSYPVEADGKTVLTDVSDEVVANIKKQGIDALVAVGGDGSL
KIALELMNKGIPVVGVPKTIDNDLMETDVTFGYNTALETATDALDKLHSTAESHHRVMIM
EVMGRYAGWIALESGISGGADVILIPEIPYDISAVCRAVDERRRRGSSFSIIVVAEGAFP
RGGNRVVQKRADETNTIERLGGIGQYVARQLGDCLDMDVRVMVLGHLQRGGSPSTFDRCL
GSRFGVAAIDLIEQEQYGRMVCLRGRDIKSVSIERAVRKLKLVNPGGQMVTAAEELGIVV
GRR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtaaagtaggcatactgaccggggggggagactgcccgggactcaatgcggtg
atcaggggagttgtcaaaagctccatcatccggcgcggctgggaagtggtcggcatcagg
gacgggttcgacggcctgctctacaacaacagaatcgtaccgctcggtctcaatgaagta
cgtggaatactcccccgcggcggaaccatcctcggtacgtccaatcgcggcaatcccttc
tcataccctgttgaagcggatggcaaaaccgttttaaccgatgtgtccgacgaggtcgtc
gcgaacatcaaaaaacagggaatcgacgcgctcgtggcagtgggaggggacggctcgctc
aagatcgcgcttgagctcatgaacaaggggattcccgttgtgggcgtgccgaagaccatt
gacaacgatctgatggagaccgatgtcacctttggctacaacaccgccctggaaaccgca
accgatgccctggacaagcttcactccacggccgagagtcaccaccgggtcatgatcatg
gaggtcatggggcgctatgccggttggatcgctctcgaatcgggcatcagcggcggtgcg
gacgtcattctcatccccgagattccctacgatatcagtgccgtctgccgcgcggtcgac
gagcggcgaagacggggaagctccttcagtatcatcgtggtggcggagggggcgttcccg
cgcggcggcaaccgggtcgtgcagaagcgggccgatgaaacgaacaccatcgagcggctt
ggggggatcggtcaatacgtggcccggcagctgggagactgcctcgacatggatgttcgc
gtcatggtcctgggccaccttcaacggggcggttcaccatcgacctttgaccgttgccta
ggcagccgcttcggcgttgccgcaatagacctcattgaacaggaacagtatggacgcatg
gtctgtctgcgcggccgcgacatcaaatcggtatccatcgagcgggcggtgcggaagctg
aaactggtgaaccccggcggtcagatggtgacggcggcggaagagctcggcatcgtggtg
gggcggcggtga

DBGET integrated database retrieval system