KEGG   Geobacter sulfurreducens KN400: KN400_1831Help
Entry
KN400_1831        CDS       T01940                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KN400_1831 (folP)
Enzymes [BR:gsk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     KN400_1831 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1940025..1940930)
Genome map
AA seq 301 aa AA seqDB search
MTSLTAQCSGTLLCAEHATGQHHAGVWQLRSRRIDLTSRPCIMGVLNVTPDSFSDGNCYL
DPAAAEDRALAMVAEGADIVDIGGESTRPGAPSVSEAEEIQRVVPLVERLAAKLPVPLSV
DTYKAAVAREALAAGAEVINDISGLTFDPGMATTVAEARAGLVVMHTRGTPAMMQRDTAY
DDLIAEVLGSLRYSMGRAQAAGIPNEQIVVDPGIGFGKSVDGNLEILRRLAEFASLGRPI
LVGTSRKSFIGAVLDRAVADRLFGTAATVAVAVANGASILRVHDVRAMRDVALMTRAIFA
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacttcattgactgcccaatgctccggaaccttactttgcgcggagcacgccaccgga
cagcaccatgccggggtatggcagctgcgtagccggcgcattgaccttacatcccgtcct
tgtatcatgggggtccttaacgtgacccccgattcattttctgacggcaattgctacctg
gaccccgctgcggcggaagatcgggctcttgccatggtggctgaaggggcagatattgtt
gatatcggcggtgaaagcacccgcccaggtgcaccttcggtcagcgaagctgaagaaata
caacgggtggtgcctcttgtggagcgccttgccgcaaaactgccggttcctctttccgtc
gatacctacaaggctgctgtagcccgcgaggctcttgccgccggcgcagaggtcatcaac
gatatcagcggcctgacctttgacccgggcatggcgaccaccgtggccgaggcccgggcg
ggactcgtggtcatgcacacacgcggcaccccggcgatgatgcagcgcgatacggcctat
gacgatctgattgccgaagtgctcggatcgctgcgctactctatgggtcgcgcacaggcg
gcgggaatccccaatgagcagatcgtagtggatccgggcatcggtttcggcaaaagcgtt
gacgggaatctggaaattctccggcgtcttgcggagtttgccagcctgggacggcccata
ctcgtcggtacttcccgcaagtcgttcataggcgccgttcttgacagggcggtagcagat
cgcctgttcggaaccgccgccacggtggcggtggccgtggcaaacggcgcctccatactg
agagttcatgatgttcgggccatgcgggatgtggccctgatgacccgggcgatttttgct
ccgtga

DBGET integrated database retrieval system