KEGG   Geobacter sulfurreducens KN400: KN400_2138Help
Entry
KN400_2138        CDS       T01940                                 

Definition
aldehyde:ferredoxin oxidoreductase, tungsten-containing
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KN400_2138
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KN400_2138
Enzymes [BR:gsk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     KN400_2138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2294455..2296194)
Genome map
AA seq 579 aa AA seqDB search
MFGWTGTILNIDLSSRAAWREDLSVELLHAYLGGRGLGVRLMRGFHALDPFDPVMPLIFA
VGPLCGTSAPTAARLTVVSRSPLTGTIYDCSAGGRFAWRLKGLGVDALRLSGRSETPVTL
VVTAGGVEFVDVPELWGKTVPETVAALSGRGSVAAIGPAGENGVLFANIMMGEGNSVGRG
GLGAVMGAKGLKAVVVNGDIPVAVADRERFDRARQDVMRLFRASPVIFGELGIAEYGTPA
LVDLMRQRRMAPTENFRHTVFEGSANYSGPAIRSAYQAKKDGCYGCPIQCKKSTPRGEHL
PEYETVSHFGALNGIASLDVIVKSNTLCNELGMDTISAAATLSAWGEVRGRFPGGEEVQR
LLVDTALRRGDGELLSLGSRRAARALGRPELSMEVKGLELPAYDPRGAYGMALAYCTSNR
GGCHLRAYPISHEILRKPVATDRFSFSGKARIIAIAEDTNAAIDSLVACKFSFFGATLEE
YAELLSAATGTEYTPQSLKEIGRRICLTERFYNCANGFDVKDDCLPARFFAEPGSSGEGV
DIPPIDRGRFDEELQKYYRIRGLTPAGTFADPDFLLTQP
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgtttggttggaccggtacgattctgaatattgatctgtcgtcccgcgcagcatggcgc
gaggatctgtcggttgaactcttgcacgcctacctgggggggagagggctcggggtccgt
ctcatgcgcggtttccatgcccttgacccctttgaccctgtcatgcccctcatcttcgcc
gtggggcccctgtgcggtacttctgcgcccacggcggcccggcttacggtagtgtcccgc
tcgcccctgaccggcaccatttacgattgttctgccggcgggcggttcgcttggcgcctc
aagggtctcggtgtggatgcgctgcgcctgtccggccggagcgagacgccggtgaccctg
gtcgtgacggcgggcggggtcgagtttgtggatgtgcccgagctttggggtaagacggtg
cctgaaaccgttgcggccctgtcagggcggggtagcgtggccgctatcggacctgccggc
gagaacggggttctctttgccaatatcatgatgggcgaagggaattcggtagggcgggga
gggcttggtgcggtcatgggggccaaggggctcaaggcggtcgtggtgaacggcgatatt
cccgtggcggttgcggatcgggagcggttcgaccgggcgcggcaggacgtcatgcgcctg
ttccgggcctcgcccgtcatcttcggtgagctgggcattgcggaatatggcacccccgcc
ctggtggacctcatgcgccagcggcgcatggcccctacggaaaacttccgccatacggtc
ttcgagggatcggcaaactactcggggccggccatccggagcgcctatcaggcgaaaaag
gacggctgctacggctgtcccatccagtgcaaaaaaagcacgccccggggtgagcatctc
cccgagtacgagactgtttcccacttcggcgccctgaacggtatcgcgagccttgatgtc
atcgtcaagtccaacaccctgtgcaatgagctgggcatggacaccatttccgcagccgca
acgctctcggcctggggcgaggtccgaggccgcttccctggcggggaggaggtgcagcgg
ctgctggtcgatacggcattacgccggggtgacggggagctgctttccttgggatcgcgg
cgcgcggcccgagcgttgggccgccctgagctgtccatggaggtaaagggactggagttg
ccggcatatgatccccgcggcgcctacggcatggccctcgcctactgtacgagcaatcgc
ggggggtgccatctgagggcctatcccatctcccacgagattctgcgcaagcccgtggcc
accgaccgtttctcgttttcgggcaaggcgcggatcattgccattgccgaagacaccaat
gccgccatcgactccctggtcgcctgtaagttctcctttttcggtgcaacgctggaagag
tatgccgaactgctctccgccgcaaccggcaccgagtacacgccccagtccctcaaggag
atcgggcggcggatctgtctcaccgaacggttctacaactgtgcgaacggatttgatgtg
aaggatgattgtctgcccgcgaggttttttgcggaacccggctccagcggcgaaggggtc
gacattccccccatcgaccgtggccggttcgacgaggagcttcagaagtactaccggatt
cgggggctcacgccggcagggacctttgcggatccggactttctgctcacgcaaccctga

DBGET integrated database retrieval system