KEGG   Geobacter sulfurreducens KN400: KN400_2143Help
Entry
KN400_2143        CDS       T01940                                 

Definition
(GenBank) aminopeptidase, M42 family
Organism
gsk  Geobacter sulfurreducens KN400
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2300834..2301898)
Genome map
AA seq 354 aa AA seqDB search
MRPESLEFFKKLVEAPSPSGYEQPAQRVFRDYIAPFAEVKTDVMGNVIGLIRGGGENLPR
VMVVGHSDEIGFQVKYIDDNGFIYFAPIGGVDAHLTPGKRVRIHTAKGEVAGVIGKKPIH
LMDEEDRRKVVRLDAQYIDIGATDKKEALEYVRVGDPVTFAAGFERLLGDRVACRAFDDK
AGSFVVAEVLRAVAESGVKLPVDLYGVSSVQEEIGLRGGATSAYSVNPHVGICVEVDFAT
DQPDVEKKHNGEVKLGKGPILPRGANINPPLFDLLSSTAEREEIAVQYTGIPRASGTDAN
VMQISRGGVATALVKLPLRYMHTPVEVISLSDLDQAVRLIVAALPGMAGDFTPR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccggaatctctggaatttttcaaaaaacttgtggaggcccccagcccttccggc
tacgagcagccggcccaacgggtgtttcgcgactacatagcccccttcgcggaggtgaag
accgatgtcatgggcaacgtgatcggtctcattcgcggcgggggggagaacctgccgcgg
gtgatggtggtcggccactcggatgagataggctttcaggtcaagtacatcgacgacaac
ggcttcatctattttgcgccgatcggcggggtggacgcccacctgacgccggggaagcgg
gttcgcatccacacggccaagggcgaggtggcaggcgtcatcggcaagaagccgatccat
ttgatggacgaggaagaccggcggaaggtggttcgcctcgacgcccagtacatcgacata
ggcgctaccgacaagaaggaggccctggagtacgtgcgtgtgggtgacccggtcaccttt
gccgccggcttcgaacgcctgctgggcgatcgggttgcctgccgggcgttcgacgacaag
gccggcagcttcgtggtggccgaggtgctccgggccgtggccgaatcgggggtgaaactg
ccggttgatctgtacggcgtctcctcggtacaggaagagatcgggctgcgcggcggcgca
accagcgcctacagcgtcaatccccacgtgggtatctgcgtcgaggtggacttcgccact
gatcagcccgacgtggagaagaagcacaacggcgaggtcaagctcggcaaggggccgatc
ctgccccgtggggccaatatcaatccgcctctctttgatctgctttcctcaacggcggag
cgtgaggagatcgctgtccagtatacgggtatcccccgggcttccggtaccgatgccaac
gtcatgcagatctcccgcggcggcgtcgccaccgccctggtcaagctgccgctccgctac
atgcatacgccggtggaggtgatttccctctccgatcttgatcaggcggtcaggctgatc
gtggcggccttgccggggatggcgggcgacttcactccccgctga

DBGET integrated database retrieval system