KEGG   Geobacter sulfurreducens KN400: KN400_2160Help
Entry
KN400_2160        CDS       T01940                                 

Gene name
cheB40H
Definition
protein glutamate methylesterase CheB associated with MCPs of class 40H, response receiver domain-containing
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KN400_2160 (cheB40H)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    KN400_2160 (cheB40H)
Enzymes [BR:gsk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     KN400_2160 (cheB40H)
Two-component system [BR:gsk02022]
 CheA family
  CheA-CheYBV
   KN400_2160 (cheB40H)
Bacterial motility proteins [BR:gsk02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    KN400_2160 (cheB40H)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2320968..2322083)
Genome map
AA seq 371 aa AA seqDB search
MRKIRVVVIDDSAYSRRAITKMLESMPEVEVIGYATDGEEGIRKIIDLKPDLVTLDLEMP
RMDGFTLLRIVMEYSPTAVIVISSRSEDEKVFRALELGAVDFVAKPTKGVSEEILTIRED
LHRKVRGVIHLNLAGIVRREREQERASVAAGRRTSGSAPYAKAAVRTESTAPRPAGRLEV
VAIGASTGGPPALQRILCALPGAFPQAVVVSQHMPAGFTRTFAERLNRLSPLEICEAADG
DEVRAGRVLIAPGGHNMVFERQGSEVRARIVKPGTDDRYVPSVDAMLLSCAEVFGPRTLG
VVLTGMGNDGSKGVAAINRAGGQTLAEAEETAVVFGMPKEAIATGVVDKIVSLDRMSREI
IQRCGLLSDVD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagatcagggtcgtggtcatcgacgattcggcctacagccgccgcgccatcacc
aagatgctcgaaagcatgcccgaggtggaggtgatcgggtatgccaccgacggcgaggag
ggtatccgcaaaattatcgacttgaaaccggacctggtgaccctcgatcttgagatgccc
aggatggacgggttcaccctcctgcggatcgtgatggaatactctcccaccgccgtcatc
gtcatcagttccaggagcgaggacgagaaggtgttccgggcgttggaactgggtgcagtt
gactttgtggcaaaacccacgaagggggtgtccgaggagattctcaccatccgcgaggac
cttcatcgcaaggtgcgcggcgtcatccacctgaacctggcgggcatcgttcgtcgcgag
cgggaacaggagcgagcttctgtcgcggccggccgcaggacctccggctccgcgccgtat
gcaaaagcagccgtgcgaaccgagagtaccgctccccgccccgccgggcgcctggaggtg
gtggccatcggtgcttccacgggagggccgccggcacttcagcggatactctgtgctctg
ccgggggcgtttccccaggcggtcgtggtctctcaacacatgccggcgggattcacgcgg
acatttgcggagcgtctgaaccggctgtcaccccttgagatatgcgaggcagcggacggt
gacgaggtgcgggccgggcgggtgctcatcgcccccggcgggcacaatatggtcttcgag
cgtcaggggagcgaggtgcgtgcccggatcgtgaagccgggcacggatgaccgctacgtg
ccgtccgtggatgccatgctcctttcctgcgccgaggtctttggtccgcgtacgctgggc
gtggtgctcaccggtatggggaatgacggcagcaaaggggtcgcggccatcaatcgggca
ggggggcagaccttggccgaagctgaagagacggcggtggtcttcggtatgcccaaggag
gccattgccaccggggtggttgacaagatagtgtcattggaccgcatgtcccgcgagatt
atacagcggtgcggtcttctcagcgacgtcgattga

DBGET integrated database retrieval system