KEGG   Geobacter sulfurreducens KN400: KN400_2238Help
Entry
KN400_2238        CDS       T01940                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:gsk00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2400231..2400836
Genome map
AA seq 201 aa AA seqDB search
MENDAALLIVDVQNDFCPGGSLAVPEGDTVVPVLNGYISVFRTAGLPIFASRDWHPRMTS
HFKEHGGQWPVHCVQGSHGAQFHPDLALPGNAIVISKGMDPERDDYSAFQGTAADGTPLP
TLLAARGIRHLYLGGLATDYCVKESALEGIRHGLIVTVLTDASRGVDLAPGDSERAVQEM
MRAGVRMTSLEGIRQEQRLRE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgatgccgcccttctcatcgtcgacgtccagaatgacttctgcccaggcgga
agtctggccgtccccgagggggacaccgtggttcctgtcctcaacggctatatcagtgtc
ttccgcacagccggactccccatcttcgcctcacgggactggcacccgcggatgacgtcc
catttcaaggaacacggcgggcagtggccggtccattgcgtgcagggaagccacggcgca
cagtttcatccagacctggcacttcccggcaacgctatcgtcatatcgaagggaatggat
ccggaacgggacgactattcggcgttccagggaactgcggccgacgggacgcccctcccg
accctgctcgccgcccgtggcatccgccatctgtacctgggaggacttgccaccgattac
tgcgtgaaggaatcggctctcgaaggaatccggcacggtctcatcgtcactgtgctgacc
gatgcatcacggggagtcgatctcgcccccggcgactcggagcgggcggtgcaggaaatg
atgcgggcgggggtgcggatgacatcccttgagggcatcagacaggaacaacggctgcgg
gagtga

DBGET integrated database retrieval system