KEGG   Geobacter sulfurreducens KN400: KN400_2313Help
Entry
KN400_2313        CDS       T01940                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KN400_2313 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KN400_2313 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KN400_2313 (trpA)
Enzymes [BR:gsk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KN400_2313 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2490006..2490800)
Genome map
AA seq 264 aa AA seqDB search
MSRIAGTFAELKHNSRKALVTFITAGDPDLAATEALIPLLAESGADIVELGVPFSDPMAD
GPTIQLSSERALAAGTTLPKILDMVRRVRTRCQVPIVLMGYYNPILIHGLERFAADASAA
GVDGVLLVDLPPEEAAEFKACADRHGLDVIFLLTPTSDEGRIRKVARQARGFVYYVSVTG
VTGARSGVEASVSSNVAAIREAITVPVVVGFGISTPDQAAQVAASADGVVVGSAIVKLFE
RFTAAELGREVATFVSALREAIGN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaattgccggcacatttgccgaattgaagcacaacagccgcaaggccctcgtt
accttcatcaccgccggtgacccggacctggccgccacggaagcgctgattccgcttctg
gctgaaagcggcgccgacatcgtggaacttggcgttcccttttcggatccaatggccgac
ggccccaccatccagctttcttccgagcgggcccttgctgcggggacgaccctgccgaag
atcctcgacatggtgcgccgggtccgtacccgctgccaggtgcccatcgtgctcatgggc
tactacaatccgattctgatccacggccttgagcgctttgcggcggatgcctcggccgcg
ggggtcgacggcgtgctcctggttgaccttcccccggaggaggcggccgagttcaaggca
tgtgccgaccgccacgggctcgatgttatcttccttctcacccccacctccgacgaaggg
cgcatccggaaagtggcgcggcaggcccgcgggttcgtctactatgtgtcggtgaccggc
gtgaccggcgcgcggagcggcgtggaggcgtccgtttcctccaacgtggccgccattcgc
gaggcgatcaccgtgccggtcgtggtcggcttcggcatctcgacgcctgaccaggctgcc
caggtggccgcctcggccgacggcgtggtcgtggggagcgccattgtaaaattgttcgag
cgtttcacggccgccgagctcgggcgtgaggtcgcaaccttcgtttccgcgctgcgcgaa
gcgatcggaaattga

DBGET integrated database retrieval system