KEGG   Geobacter sulfurreducens KN400: KN400_2321Help
Entry
KN400_2321        CDS       T01940                                 

Gene name
trpB2
Definition
(GenBank) tryptophan synthase, homodimeric beta subunit
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk00260  Glycine, serine and threonine metabolism
gsk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gsk01100  Metabolic pathways
gsk01110  Biosynthesis of secondary metabolites
gsk01130  Biosynthesis of antibiotics
gsk01230  Biosynthesis of amino acids
Module
gsk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KN400_2321 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KN400_2321 (trpB2)
Enzymes [BR:gsk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KN400_2321 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADI85133
Position
complement(2499374..2500729)
Genome map
AA seq 451 aa AA seqDB search
MQTKIVLDESRIPTHWYNIIPDMPGPLAPVINPRTLQPVTPDDLLPIFPMAIIEQEISGE
RWIPIPEEVREIYRLWRPSPLYRAHRLEQALGTPAKIYYKYEGVSPAGSHKPNSAIPQAY
YNKQAGIRRLATETGAGQWGSSLALACSMFGLECTVYMVKVSCTQKPYRKSMMQLWGANV
IPSPSEFTNAGRSILAHDPDSNGSLGIAISEAVEDAASRADTNYALGSVLNHVCLHQTII
GQEAREQLALAGDYPDVVIACCGGGSNFAGTAFPFLADRAAGKNVRCLAVEPASCPTLTK
GIYAFDYGDTAKMAPIAMMYTLGHDFMPPGIHAGGLRYHGESPLVSQLHHAGLIEAKSYR
QTACFEAAHLFARHEGIVPAPESSHAVRAAIDEAVIAKEEGKEKTILFCLSGHGQLDMVA
YDAYLSGGLEDVEYPEEMIRESLAKLPKVEL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactaaaatagtgctggacgaaagccgcatcccgacccactggtacaacatcatc
cccgacatgcccggccccctggcgccggtcatcaacccccgcacccttcagccggtgacc
cccgacgaccttctccccatcttccccatggccatcatcgagcaggagatttcgggcgaa
cggtggattccgatcccggaagaggtgcgggagatctaccgcctctggcggccgtctccc
ctctaccgtgcccaccggctggagcaggccctcggcaccccggcgaagatctactacaaa
tacgaaggggtgtccccggccggctcacacaagcccaactccgccatcccccaggcgtac
tacaacaagcaggcgggcatccggcggctggccaccgagaccggcgccgggcagtggggg
agttccctggccctggcctgctccatgttcggcctggagtgcacggtctacatggtcaag
gtgtcgtgcacccagaagccgtaccgcaaaagcatgatgcagctctggggggccaacgtg
atcccgtcgccgtccgagttcaccaacgccgggcgctccatcctggcccacgatccggac
agcaacggcagcctcggcatcgccatctccgaggcggttgaggatgccgcctcccgcgcc
gacaccaactatgccctgggcagcgttctgaaccacgtctgcctccaccagaccatcatc
ggccaggaggccagggaacagctggccctggccggcgactaccccgacgtggtcatcgcc
tgctgcggcggcggctccaacttcgccggcacggccttcccgttcctggccgaccgggcc
gccggcaagaacgtccgctgtctggccgtggaacccgcctcgtgcccgaccctgaccaag
gggatctacgccttcgactacggcgacaccgccaagatggcccccatcgccatgatgtac
accctggggcacgacttcatgccgcccggtatccacgccggcgggctgcgctaccacggc
gagtcgcccctggtgtcgcaactccaccatgccggcctcatcgaggccaagtcgtaccgc
cagaccgcctgtttcgaggcagcccacctctttgcccggcacgaggggatcgtgccggcc
cccgaatcgtcccacgcggtgcgggccgccattgacgaagcagtcatcgccaaggaggag
gggaaggaaaagaccattctcttctgcctctcgggccacggccagctggacatggtggcc
tacgacgcctacctctccggcggcctggaagacgtcgaataccccgaggagatgatccgg
gagtccctggccaaactgcccaaggtggaactgtga

DBGET integrated database retrieval system