KEGG   Geobacter sulfurreducens KN400: KN400_2322Help
Entry
KN400_2322        CDS       T01940                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gsk01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:gsk00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2500777..2501577)
Genome map
AA seq 266 aa AA seqDB search
MTDTPDILKKIVEHKRGEVAAARSAAPLAEVKARIADLEDQPRGFERALRDCHASGWTAV
IAEVKKGSPSKGVIRPDFDPLEIAETYEQNGAACLSVLTDEQFFLGNLRYLALIREQVRL
PLLRKDFLFDPYQVYEARAAGADAILLIAAMLEPAQIEDLAGFAREQYLDVLLEVHDEQE
LETALASSCTLIGINNRNLRTFVTDLGTTERLIPMIPADRFVVTESGINTRDDILRLQAA
GAHGFLIGESLMREEDIGAKLRELLG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacccccgatatcctgaagaagatcgtcgagcacaagcggggcgaagtggct
gcggcccggtccgctgccccccttgccgaggtgaaggcccgcatcgcggatctggaggac
cagccccggggcttcgagcgggccctgcgggactgccacgcctccggctggaccgccgtc
atcgccgaggtgaagaaagggtccccctccaagggggtcatccgccccgatttcgatccc
ctggagattgccgagacctacgagcagaacggcgccgcctgcctctctgtcctgaccgac
gagcagttcttcctgggcaacctccgctacctggccctgatccgggaacaggtgcggctg
ccgctgctgcgcaaggatttcctcttcgacccctatcaggtctacgaggctcgcgccgcc
ggggccgacgccatcctcctcatcgcggccatgctggaaccggcgcagatcgaggatctg
gccgggtttgcccgggagcagtacctcgacgtgctgctggaggtccacgacgagcaggag
ctggagacggcccttgcgtcgagctgcaccctgatcgggatcaacaaccgcaacctccgc
accttcgtcaccgacctgggcaccaccgagcggctcatccccatgatccccgccgaccgg
ttcgtggtgaccgagagcggcatcaatacccgtgacgacatcctccgcctccaggctgcc
ggcgcccacggcttcctcatcggcgagtccctcatgcgggaagaggatatcggggcaaaa
ctgcgggagttgctgggatag

DBGET integrated database retrieval system