KEGG   Geobacter sulfurreducens KN400: KN400_2322Help
Entry
KN400_2322        CDS       T01940                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gsk01100  Metabolic pathways
gsk01110  Biosynthesis of secondary metabolites
gsk01130  Biosynthesis of antibiotics
gsk01230  Biosynthesis of amino acids
Module
gsk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KN400_2322 (trpC)
Enzymes [BR:gsk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     KN400_2322 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh
Motif
Other DBs
NCBI-ProteinID: ADI85134
Position
complement(2500777..2501577)
Genome map
AA seq 266 aa AA seqDB search
MTDTPDILKKIVEHKRGEVAAARSAAPLAEVKARIADLEDQPRGFERALRDCHASGWTAV
IAEVKKGSPSKGVIRPDFDPLEIAETYEQNGAACLSVLTDEQFFLGNLRYLALIREQVRL
PLLRKDFLFDPYQVYEARAAGADAILLIAAMLEPAQIEDLAGFAREQYLDVLLEVHDEQE
LETALASSCTLIGINNRNLRTFVTDLGTTERLIPMIPADRFVVTESGINTRDDILRLQAA
GAHGFLIGESLMREEDIGAKLRELLG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacccccgatatcctgaagaagatcgtcgagcacaagcggggcgaagtggct
gcggcccggtccgctgccccccttgccgaggtgaaggcccgcatcgcggatctggaggac
cagccccggggcttcgagcgggccctgcgggactgccacgcctccggctggaccgccgtc
atcgccgaggtgaagaaagggtccccctccaagggggtcatccgccccgatttcgatccc
ctggagattgccgagacctacgagcagaacggcgccgcctgcctctctgtcctgaccgac
gagcagttcttcctgggcaacctccgctacctggccctgatccgggaacaggtgcggctg
ccgctgctgcgcaaggatttcctcttcgacccctatcaggtctacgaggctcgcgccgcc
ggggccgacgccatcctcctcatcgcggccatgctggaaccggcgcagatcgaggatctg
gccgggtttgcccgggagcagtacctcgacgtgctgctggaggtccacgacgagcaggag
ctggagacggcccttgcgtcgagctgcaccctgatcgggatcaacaaccgcaacctccgc
accttcgtcaccgacctgggcaccaccgagcggctcatccccatgatccccgccgaccgg
ttcgtggtgaccgagagcggcatcaatacccgtgacgacatcctccgcctccaggctgcc
ggcgcccacggcttcctcatcggcgagtccctcatgcgggaagaggatatcggggcaaaa
ctgcgggagttgctgggatag

DBGET integrated database retrieval system