KEGG   Geobacter sulfurreducens KN400: KN400_2362Help
Entry
KN400_2362        CDS       T01940                                 

Definition
SGNH-hydrolase lipoprotein, lysophospholipase L1-like subgroup
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    KN400_2362
Enzymes [BR:gsk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     KN400_2362
   3.1.2  Thioester hydrolases
    3.1.2.-  
     KN400_2362
Lipid biosynthesis proteins [BR:gsk01004]
 Fatty acid synthase
  Component type
   KN400_2362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
join(2550861..2550995,2550995..2551540)
Genome map
AA seq 226 aa AA seqDB search
MNLRKSLMAVIALTALAGCDRKEAARPAAPAQQEARATAGTIVAGGDSLTAGYGLDEHDA
YPAQLERLLREAGRPWRVVNAGISGETSSGALSRVNWVLTLKPDIVILVTGANDGLRGID
PKVTEKNLDEMVRTLKERNVTVVLGGMKMVANLGRDYTRAFAAVYPAVAKRHDLILIPFF
LEGVAGRPDLNQADGIHPTAEGYRIVSDTVLPYVIKAIEQTPPSGG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgaatctcaggaaaagtctgatggcggttattgcgctgaccgccctggccgggtgcgac
cgcaaggaggctgcccggcccgcggctccggcgcagcaggaggcccgtgccacggcaggg
accatcgtggcggggggggacagcctcaccgccggctacggcctcgacgaacacgatgcc
tacccggcccaactggagcggctgctgcgggaggccggtcgcccctggcgggtggtgaat
gcgggaatcagcggcgagacgagcagcggcgccctgtcgcgcgtgaactgggtcctaacc
ctgaagccggatatcgttatcctggtcaccggcgccaacgacggcctgcgggggatcgac
ccgaaggtgacggaaaagaatctcgacgagatggtccgcacgctgaaggagcgcaacgtc
accgtggtcctgggcgggatgaagatggtcgcgaacctgggccgggactacacccgcgcc
tttgccgccgtctacccggccgtggcgaagcgccacgacctgatcctgattccctttttc
ctggaaggggttgcagggcgccccgacctgaaccaggccgacggcatccaccccacggcc
gagggataccgaatcgtgtccgatacggtacttccctacgtgatcaaggccatcgagcag
actccgccatctggcggctga

DBGET integrated database retrieval system