KEGG   Geobacter sulfurreducens KN400: KN400_2396Help
Entry
KN400_2396        CDS       T01940                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 protein, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KN400_2396 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KN400_2396 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    KN400_2396 (sucB)
Enzymes [BR:gsk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KN400_2396 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2586310..2587521)
Genome map
AA seq 403 aa AA seqDB search
MEIKIPSVGESVFEALVATWLRQDGDAVRKDEPVCEIETDKITMELNAEADGVLSIAVPA
GTTVKIGTVIGTIREGAAAPVAESPAPAQAAAAAPAAEPPLSPSVRKMARERGISPEAVP
GTGRGGRVTVDDLFSFAEPPAGAPPPAAPQPPAQQPRPAAEQPRQAEPPEADRTTRTPMT
PIRKRIAERLMAARQQTAMLTTFNEADLGRIVELRARHKEQFAKRHGVSLGFMSFFVKAC
VEALKAFPLVNARIDGNDIVRHHYYNIGIAIGADKGLVVPVLRDADRLHFWEIEQAIAAF
VEKIKTNRLELSDLEGGTFSITNGGVYGSLLSTPILNPPQSGVLGMHAIQDRPVARDGQV
VIRPMMYLALSYDHRIIDGREAVGFLRTVKEYVEDPEELFLEG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaaaataccatcggtgggtgaatcggtattcgaggccctggtggccacgtgg
ctccgccaggacggcgatgcggtccgcaaggacgagccggtctgcgagatcgagaccgac
aagatcaccatggagcttaacgctgaggccgacggggttctctccatcgcggtgccggcc
gggaccacggtgaagatcggcacggtcatcggtaccattcgcgaaggcgctgccgccccc
gttgccgagtcgccggctccggcacaggccgctgccgccgcgcccgccgcagagccccct
ctttccccgtcggtgcgtaaaatggcgcgggagcgggggatcagccccgaggcggtgccc
ggtaccggccggggagggcgggtgacggtggatgatctcttctcctttgccgaacctccg
gccggggctcctccgccggccgctccccagcctcccgcgcagcagccccggccggcggca
gagcagccccgccaggccgagccgccggaggccgatcgcaccacccgcacccccatgacc
cccatccgcaagcggatcgcggaacgtctcatggcggcgcgtcagcagaccgccatgctc
accaccttcaacgaggccgatctggggcgcattgtggaactgcgtgcccgccacaaggag
cagttcgccaagcggcacggggtatccctggggttcatgtcgttcttcgtcaaggcctgc
gtagaggccctgaaagcctttcccctggtgaacgcccgcatcgacggcaacgacatcgtc
cggcaccactactacaacatcggcatcgccatcggcgcggacaaggggctggtggtgccg
gtgctccgggatgcggaccgcctccatttctgggagatcgaacaggccatcgccgccttt
gtcgaaaagatcaaaaccaaccggctcgaactctcggacctggaggggggcaccttctcc
ataaccaacggcggggtgtacggctcgctcctttccacccccatcctcaatccgccccag
agcggggtgctcggcatgcacgccattcaggaccgtcccgtggcccgggacgggcaggtg
gtcatccggcccatgatgtacctggccctgtcctacgaccaccggatcatcgacggccgc
gaagcggtgggattcctgcgcacggtgaaagagtatgtggaagatccggaggagctgttc
cttgaggggtag

DBGET integrated database retrieval system