KEGG   Geobacter sulfurreducens KN400: KN400_2751Help
Entry
KN400_2751        CDS       T01940                                 

Gene name
ccpA
Definition
cytochrome c peroxidase, 2 heme-binding sites
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
gsk  Geobacter sulfurreducens KN400
Brite
Enzymes [BR:gsk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     KN400_2751 (ccpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2985950..2986987
Genome map
AA seq 345 aa AA seqDB search
MKQLSVSFAVLCAVATSQAFAADELQQRAQGLFKPVPAKAPVLKGNPASPVKVELGKMLY
FEPRLSASHLISCNTCHNVGLGGGDLQATSTGHGWQKGPRNAPTVLNSVFNTAQFWDGRA
KDLAEQAKGPVQASVEMNNTPDQVVKTLNSIPDYVALFKKAFPGEKDPVTFDNMAKAIEV
FEATLITPDSPFDQYLKGKKKALDGKQTAGLKLFLDKGCVACHGGLNLGGTGYFPFGVVE
KPAENILPLGDKGRFAVTNTAKDEYVFRAPSLRNVAITYPYFHSGVVWSLKEAVAVMGSA
QFGIKLSDDESEAIAAFLGSLTGKQPKVVYPIMPASTDATPRPRL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattgtccgtgtcgtttgccgttctgtgcgcagtggcaaccagccaggcattt
gccgccgatgagctgcaacagcgcgcccagggtctcttcaagccggtcccggccaaggcg
cccgtcctgaagggcaatccggcatcaccggtgaaagtggaactcggcaagatgctctat
ttcgagccgcgactctccgcgtcccatctcatcagctgcaatacctgtcacaacgtggga
ctgggcggcggggacctccaggcaacctccaccggccacggctggcaaaaggggccccgc
aatgcaccgacggttctcaactcggtcttcaacaccgcccagttctgggacggcagggcc
aaggatctggccgaacaggccaaaggtccggtgcaggcctcggtcgagatgaacaacacg
ccggatcaggtggttaagaccctgaacagcatccccgactatgtcgccctgtttaaaaag
gcgttcccgggcgaaaaggacccggtgaccttcgacaacatggcaaaggccatcgaggtg
ttcgaggcgaccctgatcacccccgactcccccttcgaccagtatctcaaagggaagaaa
aaggcccttgacggaaaacagaccgccggcctcaagcttttcctcgacaaaggctgcgtc
gcctgccatggcggcctcaatctgggcggtaccggctacttcccgttcggggtcgtggaa
aagcccgcggagaacatccttcccctcggcgacaagggaaggtttgcggtcacgaacacc
gccaaggacgagtacgtgttccgggcgccctccctgcgcaacgtcgccatcacctatccc
tacttccattcgggcgtcgtctggagcctgaaggaagcggtggccgtcatgggttccgcc
cagttcggcatcaagctgagcgatgatgaaagcgaggccattgcagccttcctcggcagc
ctcaccggcaagcaacccaaagtcgtgtatccgatcatgccggccagcaccgacgcaaca
ccgcgccccagactgtaa

DBGET integrated database retrieval system