KEGG   Geobacter sulfurreducens KN400: KN400_3149Help
Entry
KN400_3149        CDS       T01940                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
gsk00330  Arginine and proline metabolism
gsk00332  Carbapenem biosynthesis
gsk01100  Metabolic pathways
gsk01130  Biosynthesis of antibiotics
gsk01230  Biosynthesis of amino acids
Module
gsk_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:gsk00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KN400_3149 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    KN400_3149 (proB)
Enzymes [BR:gsk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     KN400_3149 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADI85961
Position
complement(3411852..3412973)
Genome map
AA seq 373 aa AA seqDB search
MRSGILSKVKRIVIKIGSGVLTCGDNGLNKPLMGSIAAQVAELRASGRQVIIVSSGAVAA
GRKELGIDGRPRSIPQKQAAAAIGQSRLMHAYEEAFEPFGHKVAQILLTRDDLAHRGRFL
NARATLDTLLSFGVIPIINENDTVVFDEIKFGDNDSLSALVTNLAEANLLVILTDIDGFY
EANPRTNPDARLIPLVRQITREMERAAGGSGSTVGTGGMVTKLAAAKKAGQFGVPTLMLN
GRNPSLLAEAFAGREVGTLFLPGKESLNRRKHWIAHTLRPSGKIIVDDGARTVLARQGKS
LLPSGVVRVEGKFDRGACVRVCGTDGTEIARGLVDYSHDEITRILGHRSGEIEAILGYKY
GDEIIHRDNLVVL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagcggaatcctctccaaggtcaagcggatcgtcatcaagatcggcagtggggtc
ctcacctgtggggacaacgggctcaacaagcccctcatgggcagcatcgccgcccaggtg
gccgagctgcgcgccagcggccgccaggtgatcatcgtctcctcgggcgccgttgccgcg
gggcggaaagagctcggcatcgacggcaggccccggagcattccccagaagcaggcggcg
gcggccatcggccagtcgcgcctcatgcacgcctacgaggaggccttcgagcccttcggc
cacaaggtggcgcagatccttctgacccgcgacgacctggcccaccggggacggtttctc
aacgcccgggctacccttgataccctcctctccttcggggtgatcccgatcatcaacgaa
aacgacactgtggtcttcgacgagatcaagttcggcgacaacgacagcctctccgccctg
gtcaccaacctggccgaggccaatctgctggtgatcctgaccgacatcgacggtttctac
gaggcgaatccccgtaccaaccccgacgcgcggctcattcccctggttcggcagatcacc
cgggagatggaacgggctgccggcggcagcggttccaccgtcggcacgggcgggatggta
accaagctggctgcggccaagaaggccggccagttcggggtgccgacgctcatgctcaac
ggcaggaatccgtccctgctggccgaagcctttgccggccgcgaggtggggaccctgttc
ctccccggcaaggagagcctcaaccggcgcaagcactggattgcccatactctgaggccg
tcggggaaaatcatcgtggacgacggcgcccgcacggtccttgcccgccaggggaaaagc
ctgctaccgtcgggggtggtccgggtcgaggggaagttcgaccggggcgcctgcgtccgg
gtctgcggcaccgacggcactgagatcgcccgggggctcgtggactattcccatgacgag
atcacccgcatcctcggtcatcgaagtggcgagatcgaggccatcctcggctacaagtac
ggggacgagatcatccaccgggacaatcttgtggtgctgtag

DBGET integrated database retrieval system