KEGG   Geobacter sulfurreducens KN400: KN400_3513Help
Entry
KN400_3513        CDS       T01940                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
gsk  Geobacter sulfurreducens KN400
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:gsk00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:gsk00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3206184..3206744
Genome map
AA seq 186 aa AA seqDB search
MSRFEFCTTALNGVYAIRRTVAEDHRGFFSRFFCAEEFTAIGLTAPIVQINHSFTRKMGT
VRGMHFQHPPHTETKIVSCLKGCVFDVAVDLRYGSETFLKWHGEILTSENRKSLFIPEGF
AHGFQTLSEDCELIYLHTSAYDLHSEGALNAIDPQIAIEWPLAIAEMSNRDRSHPLIGTD
YKGICA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgagatttgaattttgcaccaccgcccttaacggtgtctacgccatcagacgcaca
gtagccgaagatcatcgaggattcttttcccgttttttttgcgcggaggaattcacggca
atagggctaactgcaccgatagttcagatcaaccacagctttacccggaaaatggggacc
gtaaggggtatgcactttcagcatccgccacatacggaaaccaaaattgttagctgccta
aagggatgcgttttcgatgtggctgtagatctccgatatggatcggaaacctttttaaaa
tggcatggtgaaatactaacaagcgagaaccgcaaaagcttattcatccctgaaggcttt
gctcacggctttcaaacgttgtcggaggactgcgagttaatttatctccacacgtccgct
tacgaccttcattccgaaggggcgcttaatgcgatcgacccccaaatagccattgaatgg
cccttggccattgccgaaatgtcaaaccgtgacaggtctcatcccctgatcggtacagat
tacaaaggtatttgcgcatga

DBGET integrated database retrieval system