KEGG   Galdieria sulphuraria: Gasu_03270Help
Entry
Gasu_03270        CDS       T02926                                 

Definition
alanine transaminase (EC:2.6.1.2)
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
gsl  Galdieria sulphuraria
Pathway
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:gsl01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:gsl01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gsl01230]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:gsl00710]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gsl00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 513 aa AA seqDB search
MKSLRFYSSLFRRPETQVTQYFKRFCTVSSTYVSNSYEKVLKGGGISDSVREAQYAVRGE
VPTRALQLEEELKHNKQRPYDHIIFCNVGNPQSLENPPITYVRQVLALCDFPELLNSNLF
PADAKEHAKRILISAGKGGSGAYSNSGGVSCIREDIVDFIQRRDGYESSVNNVFLTNGAS
DGIALIMKLLVSSSNSGVMVPVPEYPLYSALLSLLGAKPVRYYLNEDRNWSIELSELERA
YESSKKAGISISGIVLISPGNPTGQVLEKSNLEEIIDFAYRRRLVVLADEVYQENVYTKG
KKFVSVKKVLRDMPGKYQDVELASFHSASKGFYGECGRRGGYLEVANFNEEALEQLYKLA
SINLCANLNGQIAMSCITRHPTQGMPSYSRFEEERSNLLSSYARRAEMIQTAMNNMEGCS
CNQVEGAMYAFPRINIPPSAQQIARSQGKQPDVLYALSLLEHSGVCVVPGSGFGQKPGTF
HFRTTILPPEHDFPKVMTSFQKHHEWFLNKYKA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcttaagattttattccagtctttttagacggccagaaacacaagttactcaa
tatttcaagcgcttttgcacagtatcgtccacatacgtttctaactcttatgaaaaggtt
ttaaaaggtggcggtataagtgactcggtgcgagaggcacaatatgctgttagaggagag
gttccaaccagagcgctccaactagaagaagaattgaagcataacaaacagagaccttac
gaccatatcattttttgtaatgtgggaaacccacaatcccttgaaaatccacctatcacg
tatgttcgacaggttcttgctctttgtgattttccggagcttttgaactccaatcttttc
cctgctgacgcgaaggagcacgcaaaacgaatattgattagtgctggaaaaggagggagt
ggggcttacagtaactctggtggagtaagttgtattcgtgaggatattgttgactttatc
caacggagagatggctacgagtcatcagtcaacaacgttttcctcacaaacggagcgtca
gatggaatagctttaataatgaagttgctggtatcatcttccaactccggtgtcatggtt
cccgttccggaatatcctttatatagtgctctgctgtctttattaggagccaaacctgtt
cgatactacttgaatgaagacagaaattggtcaattgagctttccgagctagagagagcc
tatgaaagttcaaaaaaggctggaatttcaataagtgggattgttttaatatccccagga
aaccctactggtcaagttttggagaaatcgaacctcgaagaaataatagattttgcgtat
agaagaaggcttgttgttttagcagatgaagtatatcaagaaaatgtttacacaaaagga
aagaaattcgtatctgtcaagaaggttttgcgtgacatgcctggcaagtatcaagatgtg
gagttggcaagttttcattcggcatctaaaggattctatggtgagtgtggtagacgcgga
ggttatcttgaagttgcaaacttcaatgaagaggcccttgagcaattgtataagctcgcc
tcaatcaatctttgtgccaatttaaacggccagatagcaatgtcatgtatcacacgacat
cccacacaaggaatgccatcttattcccgcttcgaagaagaacgatcaaatttgttgtcg
tcatatgctcgaagagcagaaatgatacagactgcaatgaacaatatggagggttgttcc
tgtaatcaagttgaaggagcaatgtacgcctttcctcgaataaatataccaccatcagct
cagcagatagcaaggtcacaagggaagcaacctgacgttctttatgcgctgtcgttgttg
gaacattctggtgtctgtgtggttccaggaagcggttttggtcaaaaacctggaacattc
cattttcgaacgactatacttccccctgagcatgattttcctaaagtgatgacttctttt
caaaaacaccacgaatggtttcttaataaatacaaggcctag

DBGET integrated database retrieval system