KEGG   Galdieria sulphuraria: Gasu_03270Help
Entry
Gasu_03270        CDS       T02926                                 

Definition
alanine transaminase (EC:2.6.1.2)
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
gsl  Galdieria sulphuraria
Pathway
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gasu_03270
   01210 2-Oxocarboxylic acid metabolism
    Gasu_03270
   01230 Biosynthesis of amino acids
    Gasu_03270
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Gasu_03270
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gasu_03270
Enzymes [BR:gsl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Gasu_03270
Amino acid related enzymes [BR:gsl01007]
 Aminotransferase (transaminase)
  Class I
   Gasu_03270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 513 aa AA seqDB search
MKSLRFYSSLFRRPETQVTQYFKRFCTVSSTYVSNSYEKVLKGGGISDSVREAQYAVRGE
VPTRALQLEEELKHNKQRPYDHIIFCNVGNPQSLENPPITYVRQVLALCDFPELLNSNLF
PADAKEHAKRILISAGKGGSGAYSNSGGVSCIREDIVDFIQRRDGYESSVNNVFLTNGAS
DGIALIMKLLVSSSNSGVMVPVPEYPLYSALLSLLGAKPVRYYLNEDRNWSIELSELERA
YESSKKAGISISGIVLISPGNPTGQVLEKSNLEEIIDFAYRRRLVVLADEVYQENVYTKG
KKFVSVKKVLRDMPGKYQDVELASFHSASKGFYGECGRRGGYLEVANFNEEALEQLYKLA
SINLCANLNGQIAMSCITRHPTQGMPSYSRFEEERSNLLSSYARRAEMIQTAMNNMEGCS
CNQVEGAMYAFPRINIPPSAQQIARSQGKQPDVLYALSLLEHSGVCVVPGSGFGQKPGTF
HFRTTILPPEHDFPKVMTSFQKHHEWFLNKYKA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcttaagattttattccagtctttttagacggccagaaacacaagttactcaa
tatttcaagcgcttttgcacagtatcgtccacatacgtttctaactcttatgaaaaggtt
ttaaaaggtggcggtataagtgactcggtgcgagaggcacaatatgctgttagaggagag
gttccaaccagagcgctccaactagaagaagaattgaagcataacaaacagagaccttac
gaccatatcattttttgtaatgtgggaaacccacaatcccttgaaaatccacctatcacg
tatgttcgacaggttcttgctctttgtgattttccggagcttttgaactccaatcttttc
cctgctgacgcgaaggagcacgcaaaacgaatattgattagtgctggaaaaggagggagt
ggggcttacagtaactctggtggagtaagttgtattcgtgaggatattgttgactttatc
caacggagagatggctacgagtcatcagtcaacaacgttttcctcacaaacggagcgtca
gatggaatagctttaataatgaagttgctggtatcatcttccaactccggtgtcatggtt
cccgttccggaatatcctttatatagtgctctgctgtctttattaggagccaaacctgtt
cgatactacttgaatgaagacagaaattggtcaattgagctttccgagctagagagagcc
tatgaaagttcaaaaaaggctggaatttcaataagtgggattgttttaatatccccagga
aaccctactggtcaagttttggagaaatcgaacctcgaagaaataatagattttgcgtat
agaagaaggcttgttgttttagcagatgaagtatatcaagaaaatgtttacacaaaagga
aagaaattcgtatctgtcaagaaggttttgcgtgacatgcctggcaagtatcaagatgtg
gagttggcaagttttcattcggcatctaaaggattctatggtgagtgtggtagacgcgga
ggttatcttgaagttgcaaacttcaatgaagaggcccttgagcaattgtataagctcgcc
tcaatcaatctttgtgccaatttaaacggccagatagcaatgtcatgtatcacacgacat
cccacacaaggaatgccatcttattcccgcttcgaagaagaacgatcaaatttgttgtcg
tcatatgctcgaagagcagaaatgatacagactgcaatgaacaatatggagggttgttcc
tgtaatcaagttgaaggagcaatgtacgcctttcctcgaataaatataccaccatcagct
cagcagatagcaaggtcacaagggaagcaacctgacgttctttatgcgctgtcgttgttg
gaacattctggtgtctgtgtggttccaggaagcggttttggtcaaaaacctggaacattc
cattttcgaacgactatacttccccctgagcatgattttcctaaagtgatgacttctttt
caaaaacaccacgaatggtttcttaataaatacaaggcctag

DBGET integrated database retrieval system