KEGG   Galdieria sulphuraria: Gasu_04150Help
Entry
Gasu_04150        CDS       T02926                                 

Definition
beta-amylase isoform 1 (EC:3.2.1.2)
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
gsl  Galdieria sulphuraria
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gsl00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 532 aa AA seqDB search
MRLILLCQQKLIRNLRWFYFLGRRTCLVCLLLLSCSICWRLVVPANDRVSEIRYQTASKD
AIPMNVLNYSSFGVPVYVMMPLSSVTVSGDLVENYDGYDLQWILKQWKKNGVYGLMVDVW
FGVVEKTPKQYRWEPYIQLCKHLRQAGLKLQTVMSFHRCGGNVGDRCYIPLPQWVLDAAA
NNSDIFFKDQEGNVDPEYISWGVDMEPVIAGRSAIQIYSDFLASFRDNLREFLGDVIVQV
QIGLGPAGELRYPSYQLNRWTFCGVGEFQCYDRYLLSRLEQAAKEVEHPDWAHPPYPYDV
GNYNSRPEQTLFFKEDGGIWNTQYGDFFLRWYSKEMIEHADRILQVANDVFFNDKIPDSN
WKGKVRLAIKIAGVHWNFRSKSHASELTAGYYNTRFRDGYTPIFQILKKYDTTAVFTCTE
MRDKNQPQDCNCSPEDLVGLIVRASIATNVSFAGENAVSFYDADSYRQISLVARSYSVVR
GIPMEAMTYLRWPEPITIFMGDNFITPLGQKFFEFVRVMGTDDAISHVIPVF
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgagattgattctactttgccagcagaagcttattaggaacttgcgttggttttacttt
ttaggtcgtaggacttgtttagtttgtttactgttgctaagttgttctatttgctggagg
cttgtggttcctgccaacgatcgagtttctgaaatccgttaccaaactgcttctaaagat
gctattcctatgaacgttctcaactattcttcctttggtgttccagtgtatgttatgatg
cctttgagttcggtcactgtctccggcgatcttgtggagaattatgatggctacgacttg
caatggattttgaagcaatggaaaaagaacggagtatatggtcttatggtggacgtgtgg
tttggagttgtagaaaagacaccaaagcaatatcgttgggaaccctatattcagttgtgt
aaacatcttagacaagctggtttgaagcttcagacagttatgagttttcatcgctgtgga
ggaaacgttggggatcgctgttatatacctcttccgcagtgggttttggatgctgcagct
aacaattcagatattttttttaaggatcaagaaggaaatgtggatccagaatatataagt
tggggagtagatatggagccagttattgcaggacgttcggccatacaaatatattcagat
ttcttggcttcttttagagataatcttcgcgaatttcttggcgatgtaattgtgcaagtc
caaattggcttaggtcctgctggtgagttgagatatcctagttatcaattgaatcgttgg
accttttgtggcgttggagagttccaatgttatgatcgctatcttctctcaagactcgaa
caggcagccaaagaagtagagcaccctgactgggctcatccaccatatccttacgacgtc
ggcaactacaacagcagaccagagcagacgttgttttttaaagaagatggtggcatttgg
aatactcaatatggagacttctttcttcgatggtattcgaaagaaatgattgagcatgcc
gatcgtatacttcaagttgcaaatgacgtattttttaatgataaaattcccgactctaat
tggaaaggaaaggttcgcttagcaattaagatagctggcgttcattggaattttcgttcc
aagtcacatgcttcagagctcactgctggttactataatactcgtttccgagatggatat
actcctatatttcaaatcctaaagaagtatgacacaactgcggtttttacttgtacagaa
atgcgcgataagaatcagccgcaggattgcaattgttctccagaagatcttgtgggactg
attgtacgtgcttctattgcaaccaatgtttcatttgctggagaaaatgcagtgagtttt
tatgatgcagattcttatcgacaaatttcattggtggcacgttcttactcagttgtgaga
ggaatccctatggaggcaatgacctatttgagatggcctgaacctataactatattcatg
ggagataattttataactccgttgggtcaaaaattttttgagtttgttcgagtcatggga
acagatgatgccatcagtcatgtgattcctgtgttttga

DBGET integrated database retrieval system