KEGG   Galdieria sulphuraria: Gasu_04150Help
Entry
Gasu_04150        CDS       T02926                                 

Definition
beta-amylase isoform 1 (EC:3.2.1.2)
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
gsl  Galdieria sulphuraria
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gasu_04150
Enzymes [BR:gsl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     Gasu_04150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 532 aa AA seqDB search
MRLILLCQQKLIRNLRWFYFLGRRTCLVCLLLLSCSICWRLVVPANDRVSEIRYQTASKD
AIPMNVLNYSSFGVPVYVMMPLSSVTVSGDLVENYDGYDLQWILKQWKKNGVYGLMVDVW
FGVVEKTPKQYRWEPYIQLCKHLRQAGLKLQTVMSFHRCGGNVGDRCYIPLPQWVLDAAA
NNSDIFFKDQEGNVDPEYISWGVDMEPVIAGRSAIQIYSDFLASFRDNLREFLGDVIVQV
QIGLGPAGELRYPSYQLNRWTFCGVGEFQCYDRYLLSRLEQAAKEVEHPDWAHPPYPYDV
GNYNSRPEQTLFFKEDGGIWNTQYGDFFLRWYSKEMIEHADRILQVANDVFFNDKIPDSN
WKGKVRLAIKIAGVHWNFRSKSHASELTAGYYNTRFRDGYTPIFQILKKYDTTAVFTCTE
MRDKNQPQDCNCSPEDLVGLIVRASIATNVSFAGENAVSFYDADSYRQISLVARSYSVVR
GIPMEAMTYLRWPEPITIFMGDNFITPLGQKFFEFVRVMGTDDAISHVIPVF
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgagattgattctactttgccagcagaagcttattaggaacttgcgttggttttacttt
ttaggtcgtaggacttgtttagtttgtttactgttgctaagttgttctatttgctggagg
cttgtggttcctgccaacgatcgagtttctgaaatccgttaccaaactgcttctaaagat
gctattcctatgaacgttctcaactattcttcctttggtgttccagtgtatgttatgatg
cctttgagttcggtcactgtctccggcgatcttgtggagaattatgatggctacgacttg
caatggattttgaagcaatggaaaaagaacggagtatatggtcttatggtggacgtgtgg
tttggagttgtagaaaagacaccaaagcaatatcgttgggaaccctatattcagttgtgt
aaacatcttagacaagctggtttgaagcttcagacagttatgagttttcatcgctgtgga
ggaaacgttggggatcgctgttatatacctcttccgcagtgggttttggatgctgcagct
aacaattcagatattttttttaaggatcaagaaggaaatgtggatccagaatatataagt
tggggagtagatatggagccagttattgcaggacgttcggccatacaaatatattcagat
ttcttggcttcttttagagataatcttcgcgaatttcttggcgatgtaattgtgcaagtc
caaattggcttaggtcctgctggtgagttgagatatcctagttatcaattgaatcgttgg
accttttgtggcgttggagagttccaatgttatgatcgctatcttctctcaagactcgaa
caggcagccaaagaagtagagcaccctgactgggctcatccaccatatccttacgacgtc
ggcaactacaacagcagaccagagcagacgttgttttttaaagaagatggtggcatttgg
aatactcaatatggagacttctttcttcgatggtattcgaaagaaatgattgagcatgcc
gatcgtatacttcaagttgcaaatgacgtattttttaatgataaaattcccgactctaat
tggaaaggaaaggttcgcttagcaattaagatagctggcgttcattggaattttcgttcc
aagtcacatgcttcagagctcactgctggttactataatactcgtttccgagatggatat
actcctatatttcaaatcctaaagaagtatgacacaactgcggtttttacttgtacagaa
atgcgcgataagaatcagccgcaggattgcaattgttctccagaagatcttgtgggactg
attgtacgtgcttctattgcaaccaatgtttcatttgctggagaaaatgcagtgagtttt
tatgatgcagattcttatcgacaaatttcattggtggcacgttcttactcagttgtgaga
ggaatccctatggaggcaatgacctatttgagatggcctgaacctataactatattcatg
ggagataattttataactccgttgggtcaaaaattttttgagtttgttcgagtcatggga
acagatgatgccatcagtcatgtgattcctgtgttttga

DBGET integrated database retrieval system