KEGG   Galdieria sulphuraria: Gasu_05920Help
Entry
Gasu_05920        CDS       T02926                                 

Definition
stearoyl-CoA desaturase (delta-9 desaturase) (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
gsl  Galdieria sulphuraria
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:gsl01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:gsl01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 440 aa AA seqDB search
MQVQSETSLKSGTVLPDILPEPQKASEDLEYDKDRGVVFEKVKKSKYMTDQELKLLPWHK
RINWLSTAIIFTPLICLCLGIPFVKLRWQTAVLFAVQYYLTGLGITGGYHRLWAHRSYRA
TWPVEVVLALWGAAAFEGSARWWARNHRAHHRYVDSDKDPYAVHKGFWYAHLGWMVLKQD
VRRAGRVDISDLNSNRLLRFQHKYYLPIALTFGFVLPTVVAYLGWGDAWGALVYACFGRM
FFVHQATFFINSMAHTFGSQTYSTEHSSYDSIVTALFSFGEGYHNYHHEFPHDYRNGVMW
YHFDPTKWTLRFLSWFGLVKRLVRFSKNEVKKARLQVEQQNLERQMKQLDWGKPIESLPE
MTWEDVETQVEKGLYLIIIDGLVYNVTDFLPSHPGGRKILEFWNGRDASRAFNGEVYRHS
KAARNLMAHIRYAKLVEKLQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttcaaagtgagacttctttgaagtcgggcactgtgcttcctgacatacttcca
gaaccacaaaaggcaagtgaggaccttgaatatgataaggatagaggggtcgtttttgaa
aaagtcaaaaagtcaaaatatatgacggaccaggagttaaagctgcttccttggcacaag
agaatcaactggttgtccactgccattatttttactccgcttatttgtttgtgtcttggt
attccgtttgttaagttgcgttggcaaactgctgttctttttgctgttcaatattattta
accggtctcgggattactggtggctaccaccgcctttgggcccatcgttcatatagagca
acttggccggttgaggtggttcttgctttatggggtgcagcggcatttgaagggtctgca
agatggtgggctaggaatcacagagcccaccaccgttacgtggattccgacaaggatccc
tatgcagttcataaaggtttttggtatgctcatctaggttggatggtgctaaaacaggat
gtgagaagggccggacgtgtcgatatttcagatttaaattcaaataggctgctaaggttt
cagcacaagtactatctccctatagcgctaacgtttggatttgttttacctacagtggtt
gcctatcttggctggggagatgcttggggagccctagtatatgcttgttttggaagaatg
ttttttgttcatcaggccacattttttattaattcaatggcgcatacattcggttcacaa
acctattcaaccgaacattcttcttatgactccattgttactgcactgttttcatttggt
gaaggctatcataactatcaccatgagtttcctcatgactatcgcaatggtgtgatgtgg
tatcattttgatccaaccaagtggactttacgtttcttgagctggtttggcttggtgaag
cgcttggttcgtttttcgaagaacgaagtcaagaaagcaagattgcaagttgaacagcag
aatctcgaaagacaaatgaagcaattggattggggcaagccaatcgaaagtctcccagag
atgacatgggaagacgttgaaacccaggtggagaagggtttgtatcttatcattattgat
ggacttgtatacaatgtgacagattttctgcccagtcatcctggtggtagaaagatatta
gagttttggaacggtcgagatgccagtcgagcatttaatggagaagtatatcgtcatagt
aaggctgcaaggaatttgatggctcatattcgttatgcgaagttagttgagaaacttcaa
tga

DBGET integrated database retrieval system