KEGG   Galdieria sulphuraria: Gasu_05920Help
Entry
Gasu_05920        CDS       T02926                                 

Definition
stearoyl-CoA desaturase (delta-9 desaturase) (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
gsl  Galdieria sulphuraria
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gsl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Gasu_05920
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Gasu_05920
Enzymes [BR:gsl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Gasu_05920
Lipid biosynthesis proteins [BR:gsl01004]
 Desaturase
  First
   Gasu_05920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 440 aa AA seqDB search
MQVQSETSLKSGTVLPDILPEPQKASEDLEYDKDRGVVFEKVKKSKYMTDQELKLLPWHK
RINWLSTAIIFTPLICLCLGIPFVKLRWQTAVLFAVQYYLTGLGITGGYHRLWAHRSYRA
TWPVEVVLALWGAAAFEGSARWWARNHRAHHRYVDSDKDPYAVHKGFWYAHLGWMVLKQD
VRRAGRVDISDLNSNRLLRFQHKYYLPIALTFGFVLPTVVAYLGWGDAWGALVYACFGRM
FFVHQATFFINSMAHTFGSQTYSTEHSSYDSIVTALFSFGEGYHNYHHEFPHDYRNGVMW
YHFDPTKWTLRFLSWFGLVKRLVRFSKNEVKKARLQVEQQNLERQMKQLDWGKPIESLPE
MTWEDVETQVEKGLYLIIIDGLVYNVTDFLPSHPGGRKILEFWNGRDASRAFNGEVYRHS
KAARNLMAHIRYAKLVEKLQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttcaaagtgagacttctttgaagtcgggcactgtgcttcctgacatacttcca
gaaccacaaaaggcaagtgaggaccttgaatatgataaggatagaggggtcgtttttgaa
aaagtcaaaaagtcaaaatatatgacggaccaggagttaaagctgcttccttggcacaag
agaatcaactggttgtccactgccattatttttactccgcttatttgtttgtgtcttggt
attccgtttgttaagttgcgttggcaaactgctgttctttttgctgttcaatattattta
accggtctcgggattactggtggctaccaccgcctttgggcccatcgttcatatagagca
acttggccggttgaggtggttcttgctttatggggtgcagcggcatttgaagggtctgca
agatggtgggctaggaatcacagagcccaccaccgttacgtggattccgacaaggatccc
tatgcagttcataaaggtttttggtatgctcatctaggttggatggtgctaaaacaggat
gtgagaagggccggacgtgtcgatatttcagatttaaattcaaataggctgctaaggttt
cagcacaagtactatctccctatagcgctaacgtttggatttgttttacctacagtggtt
gcctatcttggctggggagatgcttggggagccctagtatatgcttgttttggaagaatg
ttttttgttcatcaggccacattttttattaattcaatggcgcatacattcggttcacaa
acctattcaaccgaacattcttcttatgactccattgttactgcactgttttcatttggt
gaaggctatcataactatcaccatgagtttcctcatgactatcgcaatggtgtgatgtgg
tatcattttgatccaaccaagtggactttacgtttcttgagctggtttggcttggtgaag
cgcttggttcgtttttcgaagaacgaagtcaagaaagcaagattgcaagttgaacagcag
aatctcgaaagacaaatgaagcaattggattggggcaagccaatcgaaagtctcccagag
atgacatgggaagacgttgaaacccaggtggagaagggtttgtatcttatcattattgat
ggacttgtatacaatgtgacagattttctgcccagtcatcctggtggtagaaagatatta
gagttttggaacggtcgagatgccagtcgagcatttaatggagaagtatatcgtcatagt
aaggctgcaaggaatttgatggctcatattcgttatgcgaagttagttgagaaacttcaa
tga

DBGET integrated database retrieval system