KEGG   Galdieria sulphuraria: Gasu_07330Help
Entry
Gasu_07330        CDS       T02926                                 

Definition
cytochrome-b5 reductase (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
gsl  Galdieria sulphuraria
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Gasu_07330
Enzymes [BR:gsl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Gasu_07330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 297 aa AA seqDB search
MPKWMTKLASFHVSSSPLQLSFIGILILCVTSLVRILFRLLKGKLFYRVNNNNLALDPLE
FRSFRLIEKAVVTPNVRLFRFAASHPEQLVNVPLGKHIYARAWINGKEVRRPYNPINKPN
QVGGCFDILVKIYPAPYGLFSRYLDSLKDGDCVEFRGPKGKFEYQRNMKKRLGMIAGGTG
ITPMYQLIETILNDPLERTQISLIYANHTEQDIIFRNKLESFASQFPNRLKLYFVLNQPP
NSWSQGIGLINEKHIQHHIGYASPSTRILVCGPPAMTKAMMILLNKLGYKGEDIFKF
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagtggatgacaaagttggcatcgtttcatgtctcatcttctcctctgcagctt
tctttcataggcattcttattctatgtgttactagtcttgtacgtattctgtttaggctg
cttaaaggaaagctattttatcgtgtaaacaataacaacttggcactggaccccttagaa
tttcgttcttttcgactcatcgaaaaggctgtcgtcactccgaatgtgagactctttcgt
tttgcagcctcccatccagaacaacttgtcaatgtacctctaggcaaacacatatatgcc
agagcttggatcaacggaaaggaagtaagaagaccttataatcccatcaataaacccaat
caagtgggtggttgttttgatattttggtcaagatttatccagctccgtacggtctcttt
tctagatatttagactcattaaaggatggtgattgtgtcgaattccgtggtccgaaaggc
aaattcgagtatcaaagaaatatgaagaaacgtcttggaatgatagctggaggaactgga
ataactcctatgtatcagttgatagagacgatactgaatgatccattggaacgaacacaa
ataagtttgatatatgctaatcatacggaacaagatattatctttagaaacaaattggaa
tcttttgcatctcaattccccaatcgactgaagctctattttgtgttgaatcaaccgcct
aattcatggtctcaagggataggtcttatcaatgaaaagcatatacaacatcacataggt
tatgcatctccttctactaggattttggtttgtggtccacctgcaatgaccaaagctatg
atgatattgttgaacaaattgggctacaaaggagaagatattttcaagttttaa

DBGET integrated database retrieval system