KEGG   Galdieria sulphuraria: Gasu_09770Help
Entry
Gasu_09770        CDS       T02926                                 

Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl00860  Porphyrin and chlorophyll metabolism
gsl01100  Metabolic pathways
gsl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Gasu_09770
Enzymes [BR:gsl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Gasu_09770
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Gasu_09770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 Thi4 HI0933_like GIDA IlvN 3HCDH_N AlaDh_PNT_C Pyr_redox
Motif
Other DBs
NCBI-GeneID: 17090521
NCBI-ProteinID: XP_005708430
UniProt: M2X604
Position
Unknown
AA seq 570 aa AA seqDB search
MSSGFLCFCPNAVIKAAQYVRPKNTFSCKHYTCKNRNSWFYGNELYIKRRKVVEQQRTTS
HVSKLPFRQTWKAVSAQHTEDGECSVLIIGSGVTGSTAAFQLAESGIDVLVAEKNEQVGG
NIISRKEQGFIWEEGPNTFQPTPDILVMIEKLGLVDKLVLADAKLPRYVFYQDKLHKIPS
SPFEACQFSLLSTRGKLRAFLGAIGFAPMNLKKKEETVRDFVTRHLGEEVYERLVDPFIS
GVYAGDPSKLSMKAAFKRVQALEEKGVTQSLIEGAIIRMFETKNSKGKKETKGSLKVPRG
SLGSFKDGLQMYPQSVQSKLSNKVKTGWKLIRLEKSGNGSSHQSCEDYFAVFQIPNGITK
VIRTKALIFTSPAYITASLLRPFIPNASDLLEQIYYPCVVSVSLAYPSSSFRFPLSGFGH
LIPRSTKIRTLGTIWSSSLFPYRVPEGYHLLSSYIGGAQDTDIASLSEDQVVKQVDSDIR
KILLRQDAALPKVLGVRHWNKAIPQYELGHLSRMETIQSQVSETLPGVFLGGNYVSGISF
GDCVSFGMQLADQASYYIKENTELLSSTVV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtggattcttgtgtttttgtccaaacgcggttatcaaagcagctcagtatgtg
agacctaaaaacactttttcgtgtaagcactatacctgcaaaaatagaaatagttggttt
tacggcaatgagttgtatataaagagacgtaaagtggtcgaacagcagagaacaactagc
cacgtttctaagttgccttttcgtcaaacatggaaagctgtttcagctcagcacacggaa
gatggcgaatgtagtgtattgattattggttctggcgtcacaggaagtactgctgctttt
caattggccgaaagtggcattgatgtcttagtagctgagaaaaatgaacaagtcggagga
aatatcatttctagaaaggagcaaggtttcatttgggaagaaggtccaaatacattccaa
cctactccagatattcttgttatgatcgaaaagttaggtttggtagacaaactggtctta
gctgatgcaaagctgccacgatatgtgttctaccaggataaacttcataagattccttca
agtccttttgaagcctgccaattttctctgttgtcgacaagaggaaaattgcgtgccttt
ctaggagctattggctttgctccaatgaatctcaaaaagaaagaggaaaccgtaagagat
tttgtaacgagacatttgggggaagaggtatatgaacggcttgtggatccttttattagt
ggagtatatgctggtgatccttccaagctgagtatgaaagcagcattcaaacgagttcaa
gccttggaagaaaaaggtgttacccaaagccttattgaaggtgctattattcgaatgttt
gaaacaaagaacagtaaaggaaagaaagaaacaaaaggttctctcaaggttccaagaggc
tctcttggttcattcaaagatggcttacaaatgtacccccaatcagtacagtcgaagctt
tcgaacaaagtgaagactggatggaagttgataagactggagaagagcggaaatggaagc
agtcatcagtcatgtgaggattactttgcagtgtttcaaatacccaatggaatcaccaaa
gtaatacgtacgaaggcattgatatttactagtcctgcttatatcactgcatctcttttg
agacctttcattcccaatgcatcagatctgttggagcaaatctattatccttgtgtagta
tcagtatccttagcgtatccctcttcatcttttcgatttcctttatctggttttggtcat
ttgattccaagaagtacaaaaattcgtactttgggtaccatttggtcgagtagtctattt
ccatatcgagtacctgaaggttatcatcttttatcctcttacattggaggtgctcaggat
acggatattgcttcgctatctgaagaccaagttgtgaaacaagttgattctgatataagg
aaaatacttttaaggcaagatgcagctcttccaaaggttttgggagtacgtcattggaac
aaggccattccgcaatatgaactaggtcatctctctcgaatggaaactattcaaagtcaa
gtcagtgaaactcttccaggtgtgtttttgggtggtaattatgtcagcggaatttctttt
ggagattgtgtgtcatttggtatgcaacttgctgatcaagcatcttactatatcaaagaa
aatacagaattgctttcttcgacagtcgtttga

DBGET integrated database retrieval system