KEGG   Galdieria sulphuraria: Gasu_10110Help
Entry
Gasu_10110        CDS       T02926                                 

Definition
histone acetyltransferase HTATIP (EC:2.3.1.48)
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
gsl  Galdieria sulphuraria
Brite
Enzymes [BR:gsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Gasu_10110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 409 aa AA seqDB search
MSESPKDMSIEENVPMLLEDTASLQKGLWKERPLDIGLKLPCRWRDGTWQEAEILERKQD
SVSSEFLYYVHYSGFNRRLDEWVDSGRIDWKAIEEGRVRWNKTTSNKKKKDKKRKSSDDT
ENRKIEPAKLENITKVKNVDRIVLGKYIMETWYYSPLPPEYHHCSTLWVCEYTLNFLRSE
AALKRYQQRHSIRTPPGNEIYRKDNISVFEIDGAVQKFYCRNLSYLSKFFLDHKTLYYDV
DPFWFYVMCEVDEYGCHIVGYFSKEKESEDNYNVACILTFPAYQRKGYGKFLISFSYELS
KLEQKVGSPEKPLSDLGLLSYRSYWSQVLVDLLKNEKQPISIQEISERTMMKMEDIISTL
QVLGLIQYYEGQHVLDLRRIDNIKFGSKGLQCDSSSIRWTPKLTTFINK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagtcccaaagatatgtctattgaagaaaatgttcccatgttgttggaagat
actgcttcacttcaaaaaggcttgtggaaggagagacctttggacattggtttgaaactt
ccttgtcgttggcgagacgggacttggcaagaggctgaaattttagaaaggaagcaagat
agcgtttccagtgaatttttatactatgtacattatagcggctttaatagacgtttagac
gagtgggtggatagtggtagaatagattggaaagctatagaagaaggaagagttcgctgg
aacaaaactacttctaacaagaagaaaaaggataaaaaacgcaaaagttccgacgatacg
gagaacagaaagatagaaccagcaaaactagagaatattactaaagtgaaaaatgttgat
agaattgtattgggaaagtatattatggagacttggtactatagtcctcttcctcctgaa
tatcatcattgttctacattatgggtttgtgagtacacactcaactttctacgctcggaa
gctgcactcaagcgatatcaacaaagacacagcattcgaacacctccaggcaatgaaatt
tatagaaaggataacatttcagtatttgaaatagatggggctgtacagaaattttattgt
cgaaacttgagttatttgtcaaagttctttctagatcataaaactctgtactatgatgtg
gacccattttggttttacgtgatgtgtgaagtggatgaatatggatgtcatatcgtaggt
tattttagtaaggaaaaggaaagcgaagataattataacgttgcctgtatcctaacattt
ccggcttatcaacgcaaaggatatggaaaatttctcatttcattttcttatgaactttct
aaactagaacaaaaagtaggtagtccagagaagcctttaagtgatttgggcctattgagt
taccgaagttactggagtcaagttcttgtcgatctattaaagaatgaaaagcagcccatt
tccattcaagaaataagtgaaaggacgatgatgaaaatggaagatattatttctacctta
caagtattgggacttatccaatactatgaaggacaacatgtactcgatcttcgtcgaatc
gataatatcaaatttggtagtaagggactacaatgcgactcctcttctattcgatggact
cccaaattgacaacttttataaataagtag

DBGET integrated database retrieval system