KEGG   Galdieria sulphuraria: Gasu_16010Help
Entry
Gasu_16010        CDS       T02926                                 

Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase 3 isoform 1 (EC:1.3.99.5)
  KO
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
gsl  Galdieria sulphuraria
Brite
Enzymes [BR:gsl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Gasu_16010
    1.3.1.94  polyprenol reductase
     Gasu_16010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 278 aa AA seqDB search
MLDELVTIFWLVALVAYACKYFYPTWSHIISYGRIVYREEEEKCKILQRNNMTVQKGNLS
LMEKTLSGLLSYLLSSRIEYRTGFTHFYGIGCIASLVLFYFQNFHGIGKARRVCSSWLFL
LHTSRRLYESLFMQVYSKRKMHLLHWFAGTSYYLFAACTFCWHDDHPYWSLSKGWLALVF
IVFVWSNYQQYLCHQHLAQLRRKDGTDNKRYYIPYRGLFRYVVCPHYMLEIIIYGVLVSG
SWAWFSFRVILIGFGEGRLKEQFSEFCFCCAQFDKSVY
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgagttggtgacgatattctggttggttgctcttgttgcttatgcttgcaaa
tatttttatcccacctggagtcacatcatatcttatggaagaatagtatatagagaagaa
gaagaaaagtgtaaaatattgcaaagaaataatatgactgttcaaaaaggaaacctttcg
ttgatggaaaagacactgtcaggattgttatcctatcttttgtcttctagaatagaatac
cgtacaggatttacccatttttatggcatcggttgcattgcttcgttggttttattctat
tttcaaaacttccatgggattggaaaggcgagaagagtgtgttctagttggttatttctt
cttcatacgagtagaaggttatacgaatctttgttcatgcaggtctatagtaagagaaag
atgcacttgttgcattggttcgcaggtacaagttattatttgttcgctgcttgtactttt
tgttggcatgatgaccatccctattggtcactttctaaagggtggcttgcgttggtattt
attgtttttgtatggagcaattatcaacagtatttatgtcatcagcacttggcacaactg
agacggaaggatggaacagacaacaagcgttattatattccataccgaggactatttcga
tatgttgtttgcccacattatatgttggaaataatcatatatggagttttggtgagtggt
agttgggcttggttttcattcagagtgattttgataggttttggggaagggaggctcaag
gaacagttttctgaattttgtttttgttgtgctcaatttgacaagtcggtctattga

DBGET integrated database retrieval system