KEGG   Galdieria sulphuraria: Gasu_16100Help
Entry
Gasu_16100        CDS       T02926                                 

Definition
glutamate decarboxylase isoform 1 (EC:4.1.1.15)
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
gsl  Galdieria sulphuraria
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsl00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Gasu_16100
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gasu_16100
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Gasu_16100
   00430 Taurine and hypotaurine metabolism
    Gasu_16100
Enzymes [BR:gsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Gasu_16100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 492 aa AA seqDB search
MPLHPVHSKPSQQKDNEDSLCGSVFASRYMSKPIPTYRMPEEAMPPEVAYQLIHEELALD
GNPQLNLASFVTVWMEPQADRLMTENIGKNFIDLEEYPCTAELQKRCVNMIAHLFHVPTE
QGQSDSVGTATVGSSEAIMLAGLAFKWRWKQARKQAGLSTEKPNLVMGSNVQVCWEKFCR
YFEVEARYVPVSENLLIMEPEKAMSYVDENTIGVCSILGSTYNGAFEDVKKLNDCLCKLN
EEKGWNVPIHVDAASGGFIAPFLYPDLVWDFRLPLVRSINVSGHKYGLVYPGVGWVVWKS
QEDLPQDLIFHVNYLGADQATFTLNFSKGAGQIVAQYYQFIPMGQNGYRAVLSNLQKICQ
YLRKKVEESGRFRVYSDEVSVPLVAFGLKEPQAYDEFDISHRLKEYGWIVPAYNFPPKAE
HIKVLRVVIRETFSRDLCDMLWRDLMWTLEELDRKTPDSIRHGRELLMEKNRQKHKAFAH
VKSQKQKTNGVC
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcctctccatccagtacactcgaagccttctcaacaaaaggataatgaagactcacta
tgtggatcagtatttgcttcaagatacatgtcaaagcctatacctacatatcgcatgcct
gaggaagccatgccaccagaagtggcttaccagttgattcacgaagaattggcactcgac
gggaatccacagttgaacttggcgtcttttgtgaccgtatggatggagccccaagcagac
cgtcttatgactgaaaatattggtaaaaattttattgacttggaagaatacccttgtact
gcagagttacaaaagcgttgtgtcaatatgattgcacacctctttcacgtacctacagaa
caaggtcaatcggactctgtaggcacagctacagtagggagttcagaagcaatcatgttg
gctggtttggctttcaagtggcgatggaaacaagcaagaaaacaagcgggattgtcaaca
gaaaaacccaatcttgtgatgggatccaatgtgcaagtatgttgggagaagttttgtcgc
tattttgaagtagaagcacgttatgtaccggtatcggagaatcttttgattatggaacca
gaaaaagccatgtcctatgtggatgagaataccatcggtgtttgcagcattcttggaagc
acatataatggtgcatttgaagatgtgaaaaaactaaatgactgcctttgcaagttgaat
gaagaaaaaggttggaacgttcctattcatgtggatgcagcttctggtggttttattgca
ccttttctttatcctgatttggtttgggactttcgtcttcctctcgtacgttccatcaat
gtttctggacataaatatggccttgtgtatcctggtgtgggatgggttgtatggaagagt
caagaggatttaccacaagatttgatatttcatgtaaactatttgggagcagatcaagct
acatttactctcaacttttcaaaaggagcgggtcagatagtagcacagtattatcaattc
attcccatgggacaaaatggatatagagctgtgttaagtaaccttcaaaagatatgtcag
tatttgagaaagaaagttgaagagagtggacgctttagagtttatagtgatgaagtgagc
gtacctttggttgcctttggtttaaaagaacctcaagcatatgatgaatttgatatctca
catcgtctaaaggaatatggctggatcgttccagcatataattttcctcccaaggctgaa
catatcaaagttcttcgagtagtgattcgtgaaactttttctagagatttatgtgatatg
ttatggagagacttgatgtggacgttggaggaattggacagaaaaactcccgactctata
cgtcacggcagagaattgctgatggaaaagaatcgacaaaagcacaaagcatttgctcac
gtgaaaagtcaaaaacaaaaaaccaatggagtctgttag

DBGET integrated database retrieval system