KEGG   Galdieria sulphuraria: Gasu_16800Help
Entry
Gasu_16800        CDS       T02926                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
gsl  Galdieria sulphuraria
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gsl00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Gasu_16800
Enzymes [BR:gsl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     Gasu_16800
Glycosyltransferases [BR:gsl01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   Gasu_16800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 515 aa AA seqDB search
MESSKRTTMNQHSSSKSNGSVGRPYSSKIKKSHLRNKYLTFLLKASQFDKTDGWNLLLLT
FLALATRFWRLFYPAAVVFDEFHFGKFVTWYFKHQYYFDIHPPLGKLILYLGGLLGGYNP
GFLYDAIGAEYGDTKFQVLRSVSALFGVLSVPLMYCTCRELNISPVGSFAGASMVLLDFL
SLIESRLILVDSQLLFFCMASFYSALKLWKYKRENRKKSFLFFLVLTGILCGCAISVKWT
ALATPGIIAIVSFFGLHFLNEPLEIWECLIAGLSGIIVYLFVFYVHFQLLPFSGSGDAFM
TPEFQKTLIGNPFYHPAATRQPFLTSFFQLNREMFRANKGIKDRHPWESKWYEWPLNLRG
LLYFVQEDDEDDSRMSQIYLIGNPAVMYLCLLSALIFLLCAIFFGRYRYAISSKADLRSL
MEKGGILCAAYALNLLPYIAVERSAFLYHYIPGLFYAELLTALVIDRFPKSYKLVFIIVI
FILEVAAFVYWAPWVYAISLTKIAHDKRRWLPRWN
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggaaagttctaaacggacaaccatgaatcaacatagctcttctaaaagcaatgggtca
gttggacgaccttatagttccaagataaagaaaagccacctgagaaacaaatatctcacg
ttcttgctcaaagcaagtcaattcgacaaaacagacggttggaacttgctattgttgact
tttttggctttagctaccagattctggcgtttattttaccctgctgcagttgtctttgat
gaatttcactttggcaaatttgtcacttggtactttaagcatcaatattatttcgacatt
catcctcctttgggaaaattgattctgtatcttggtggtttattgggtggatacaatcct
ggttttctttatgatgctattggtgcagaatatggtgataccaagttccaagttttacgt
tcagtatcggcattgtttggtgtcttgagcgttccactcatgtattgcacctgtagagaa
ttgaacatttctccagttggttcttttgccggtgcaagtatggttttacttgatttcctc
tctttgattgagtctcgtcttattctagtggattctcagcttttattcttctgcatggct
tccttctatagtgccttgaaattgtggaaatacaaaagagaaaaccgcaaaaagtcattc
cttttctttttggttttaactggaatactttgtggttgtgcaatttcggtgaaatggact
gcacttgcaactccaggaatcattgctattgtgtctttctttggacttcactttctaaat
gaacctcttgaaatctgggaatgtctcattgctggtcttagtggcattatagtgtatcta
tttgttttttatgttcattttcagttgctacccttttcgggatctggagatgctttcatg
acaccggaatttcaaaagactcttattggcaatccgttttatcatcctgctgcaacgcga
caacctttcttgacaagtttttttcaattgaatcgggaaatgtttcgtgccaataagggt
atcaaggatcgccatccatgggaatctaaatggtatgaatggccacttaatctccgtgga
ctattgtactttgtccaagaagatgatgaagatgactctcgaatgtcacaaatatatcta
attggaaatcctgctgtgatgtacctttgtctattaagtgcattgatattcttattatgt
gctatattctttggcagatatcgttatgccatatcatcaaaagcagatttacgaagtttg
atggaaaaaggtggcatattatgtgcagcatatgcattgaatttacttccttacattgcg
gtggagcgaagtgcctttttatatcattatattccaggtctattttatgcagagttactt
actgctttggtaatcgatagatttcccaagtcttacaaacttgttttcattattgttata
ttcatattggaagtggcagctttcgtttattgggctccatgggtttatgccatttcatta
acaaaaatagcacatgataaaaggcgttggttacctcgttggaattag

  All links  
No link information was found.   
DBGET integrated database retrieval system