KEGG   Galdieria sulphuraria: Gasu_20650Help
Entry
Gasu_20650        CDS       T02926                                 

Definition
mono-ADP-ribosyltransferase sirtuin 6 (EC:2.4.2.31)
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
gsl  Galdieria sulphuraria
Brite
Enzymes [BR:gsl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     Gasu_20650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 407 aa AA seqDB search
MVNVASNEYAYLLSPCEAKGKLDLKEEEESRVSLSLKLRKLVEFIRQSDHVVVHTGAGVS
TKAGIADFRGPRGFRDALPTITHFGIAQLCKEKLVRFVVTQNVDGLHRKSGVPEHLLAEI
HGCLFVGYCTKCERKQVLDKPTHSVGFRDIQIPCSRCSYSLCDFVLDWYDELPKVDLEKA
IFHSRKADLHIVIGSSLQMLPSKNFCLMSVKTGARLVILNLSETSHDSKATMILRGDSDR
CISAILFLLQLPVALFVPKQAVQVNATVNDKDKSEMETCDWQLKVDCNTFPRHPCRIQPK
QVETHSLYSFMDWTWNEENGLLTIWISSIVVPTVSITFCIFFPNLPCCCFTVQHSFSKNA
FKNYGSSEWFQLSSISSVTDVVEGFHLAYETLDQKIIQQNFVYYVKR
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatgttgcttcaaatgaatatgcctatcttctatcaccttgtgaagccaaagga
aaactagacctaaaagaggaggaagaaagtagagtctcactttcgttaaaactaagaaag
ttggtagagtttattcgacagagtgaccatgttgtagtacacactggagccggagtttcc
accaaggcaggaatcgcagatttccgaggtcctcggggttttcgagatgccttgccaacc
attactcactttggtattgctcagttgtgtaaggaaaagctagtccggtttgttgtcacg
cagaatgtggacggacttcacagaaagtcaggtgtacctgaacatcttttagcagagatt
catggctgtctatttgtcggatattgtacaaagtgtgaaaggaaacaagtactggacaaa
ccaactcattctgtcgggtttagggatatccaaataccttgttctcgttgttcctattcg
ttgtgtgactttgttcttgattggtatgatgagcttccaaaggtcgatctggaaaaggca
atttttcattctaggaaagcggacttgcatatagttattgggtcaagtcttcagatgctt
ccttctaaaaatttctgtttgatgtcagtcaaaactggagcacgactggttattttgaat
ctttccgaaacaagtcatgattctaaggccacaatgatattaagaggagattctgataga
tgtatttctgccattttattcttgttacaactgccagttgcattgtttgttccaaagcaa
gcagtacaagtcaatgctacagtgaatgacaaagacaagagtgaaatggaaacttgtgat
tggcagcttaaggtggattgtaatacatttcctcgccatccttgtcgcattcaaccgaaa
caagtcgaaactcattcgctatattcttttatggactggacatggaacgaggaaaatggg
ttgctaactatatggatttcatcgatagttgttcctacagtttccataactttttgtata
ttctttcctaatcttccctgttgttgttttacagtacaacatagcttttcaaaaaatgct
ttcaaaaattatggttcctctgaatggtttcaactatcatccatttcttcagtgacggat
gtagtagaaggtttccatctggcttatgagactttggatcagaagatcatccaacaaaat
tttgtttactatgtgaaaagatag

DBGET integrated database retrieval system