KEGG   Galdieria sulphuraria: Gasu_25290Help
Entry
Gasu_25290        CDS       T02926                                 

Definition
ubiquitin carboxyl-terminal hydrolase L5 (EC:3.4.19.12)
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
gsl  Galdieria sulphuraria
Brite
Enzymes [BR:gsl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Gasu_25290
Peptidases [BR:gsl01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Gasu_25290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 299 aa AA seqDB search
MEDGGWNTIESDPAVFTQLLEDLGVKDVKVEEVLQLDAAFLRSLEPVHGLIFLFKWLPDQ
GSEQELSFSQDVDLFFANQVIQNACGTQALLSVVFNAKDLELGSELAEFKEFTKDFDPQT
RGLALSNSETIRSAHNSLSGLQHFSFEFDEKEKSDSFHFISYVPFQGRIYELDGLKKGPI
CRGSYTAERHWTDVAISEIEKRIERYGEGEIRFNLLAVVRDPLKIWQQELLSYQTALESC
SLEVERMSISMQMKEIQTRMEDEKRRSIRRESNRRRHNMLPFIFHLFKWLHENSDLSFT
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggaggatggcggttggaatactattgaatctgatccagcagtctttactcaactcttg
gaggatcttggtgtcaaagatgtcaaagtagaagaagttctacagttagatgcagctttc
ttacgtagtttagagccagttcacggtctcatatttctattcaagtggttgccagatcaa
ggaagcgaacaagaattgtccttttctcaagatgtcgatttattctttgccaatcaagta
atccaaaatgcttgtggcactcaagcactactctctgttgttttcaatgcaaaggacttg
gaactaggctctgaacttgccgagtttaaggaattcaccaaagactttgatccacaaacc
cgtggtttggctctgagtaactcggaaacgattcgttctgcacataatagtctatcagga
ttgcagcatttctcttttgagtttgatgagaaagagaaaagcgattcttttcactttata
agttacgttccatttcaaggaaggatttacgaattagatggtttgaagaaaggccccatc
tgtagaggttcatatactgcggaaagacattggacagatgtagctatctcagagatagag
aaacgtattgaacgatatggtgaaggagaaatacgtttcaatttgttggcagttgtgagg
gatcctttaaagatatggcaacaagaattgctatcttatcaaactgccttggaaagttgt
tctctggaagtggaacggatgagtatttccatgcaaatgaaggagatacaaactcgcatg
gaagatgagaagaggagaagtattcgaagagagtcgaacaggagacggcataatatgtta
ccatttatctttcatttgttcaaatggttgcatgaaaatagtgacttgtcatttacatag

DBGET integrated database retrieval system