KEGG   Galdieria sulphuraria: Gasu_29320Help
Entry
Gasu_29320        CDS       T02926                                 

Definition
beta-amylase (EC:3.2.1.2)
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
gsl  Galdieria sulphuraria
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gasu_29320
Enzymes [BR:gsl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     Gasu_29320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 523 aa AA seqDB search
MHLLKRRYGCHSRPTTFITGWTIFVLFCIACYSVVFKSHASFPLHNKDAAGSPMKGGSIP
NAPGVPIYVMMPLTSVSDDGQLKKDYDGKNISWILEQWKKLGVEGLMVDIWFGLVEKEPR
QYDWKPYIELCQLMKSANLKLQTVLSFHRCGGNVGDRCYIPLPKWIFAVAENDSDIFFKD
RDGSADDEYLSWGIDEEPVLMGRTAVQVYQDFFISFRETFREFFGNVISQVQIGLGPAGE
LRYPSYQLNKWTFCGVGEFQCFDKYLLGRLQSEADKHGISEWGHPPYAKDVGFYNSSPSE
TLFFRDDGGMWNTRYGDFFLNWYSNELIQHADRVLTAATQVFFDLSNPNNDFTGQFHLAV
KVAGVHWHFRSKAHASELTAGYYNTRYRNGYSPIFRVLKKHEATVVFTCMEMKDNNQPKD
CYCSPEDLVGLIVRSSIANNISFAGENAVSFYDVESYRQISAVSRSYAVTKGKPMEAVTY
LRWPEPIDIFFQKDTLSILGQKFFDFVRSMAYDQAESTDFPGL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcatctattgaaaagaagatatggatgtcattcgaggccaactacttttatcacaggc
tggaccatctttgtgttgttttgtatagcttgttattcagttgttttcaaaagccacgct
agttttcctttgcacaacaaagatgctgcaggcagtcctatgaaaggtggatctataccc
aatgcccctggagttccaatttatgttatgatgccactgacgagtgtttctgatgacggg
caactaaaaaaagattatgatggcaagaatatcagttggattctagaacagtggaagaaa
cttggagtagaaggtctaatggtggacatatggtttgggttggtagaaaaagagcctcga
caatatgactggaaaccttatatcgaattgtgtcagttgatgaagtctgccaatctcaaa
ctacagacagtacttagctttcatcgttgtggtggaaatgtgggtgatcgttgttatatt
ccattgcccaagtggatatttgcagttgctgagaatgactctgatatctttttcaaggat
agagatggaagtgcagatgacgaatatctaagttggggtatcgatgaagaacctgttttg
atgggaaggacagctgtccaagtctatcaagacttttttatatcttttcgggaaactttt
cgagaattttttggcaatgttatcagtcaagtacagattggattgggtcctgctggagaa
ttacgctatcctagttatcaattgaacaagtggactttttgtggagttggggaattccag
tgttttgataagtatctcttaggtcgtctacagtcagaagcagataaacatggaatatcg
gaatggggacatcctccttatgcaaaggatgttgggttttataatagctcaccttcagag
acattgttctttcgagatgatggcggtatgtggaatacgagatatggtgactttttctta
aattggtattctaatgagcttattcaacatgctgatagagttttaactgctgctactcaa
gtttttttcgatctttccaatcccaacaacgactttacgggtcagttccacttggcagtg
aaagtggctggtgttcattggcattttcgttccaaagcgcatgcatcggaattaactgcc
ggttattacaacactcgataccgaaatggatattcacctatcttccgagtcttgaagaaa
catgaagcaacggttgtattcacttgtatggaaatgaaggataataatcaacccaaggat
tgttattgttctccagaagacttggtgggacttatcgttcgaagttctatagccaacaac
atttcttttgctggagaaaatgcagttagtttttatgatgtcgaatcttatagacaaatt
tctgcagtatcacgttcgtatgcagttaccaaaggcaaaccaatggaagcagtgacctat
ttacgttggccagagcctattgatattttctttcaaaaggatactttgagcattttgggt
caaaagtttttcgattttgtgcgttcaatggcttatgatcaagcagaatctacagacttt
cctggtttataa

DBGET integrated database retrieval system