KEGG   Galdieria sulphuraria: Gasu_35830Help
Entry
Gasu_35830        CDS       T02926                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
gsl  Galdieria sulphuraria
Brite
Enzymes [BR:gsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Gasu_35830
Transcription machinery [BR:gsl03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Gasu_35830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 423 aa AA seqDB search
MSQDNKEEPKEVPVNGNVPLTGEIPLDFRLTPCCEVPKAKRPRPVPEGAWEMSTEGILGP
DSQHAYVQRWYSMVQQEKSGAVKFQVVRNDSKRESLILLLGLKNVFVRQLPNMPKPYVTR
LVFDRKHESTILTKCTSSGEYVVMGGCCYRPFIEERFAEIAFLAISDSEQVRGYGTRLMS
YTKERTKELGLTHILTCADNNAVPYFKKQGFSKTITLEKERWQGYIKDYDGVTLMECVLN
PKVDYLNIPSMLKAQKMCLIEKLKEISNIHIVYPGLDPEARKRIRLEDIPGLKEGLEQSE
RSLGKTIPLESLAAPRDPASLQALHKELQHILTQVKQHQSAWPFLEPVDPEQTGALDYYD
VIKNPIDLRTIQERLDRGDYYVTKEIFAADLKRMIENCEAYNGEKHFITELAHNLERFFN
QKL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagataataaggaggaacctaaggaagttccagtcaatggcaatgtgcctctt
actggagaaattcccctagattttcgcctgactccctgttgtgaagtacctaaagctaaa
cgtcctcgtccagttccggaaggcgcttgggaaatgtccacagagggcattcttggacca
gattctcaacatgcctatgtacagagatggtactcaatggttcagcaagaaaagtccggg
gctgtcaagttccaagtggttagaaacgatagcaaacgagaaagcttgatattactccta
ggactgaaaaatgtttttgtaaggcaattgcctaatatgcccaaaccttatgtgacgcga
cttgtcttcgaccgaaagcacgagtcgactattcttacaaagtgcacaagtagtggagaa
tatgtggttatgggaggctgctgttatagacctttcattgaggaacgctttgcagagatt
gcatttttagccatttccgatagtgaacaagttcgaggatatgggacaagacttatgtcg
tataccaaagaacgaacgaaggaactaggactaactcatatacttacttgtgcagataat
aatgcagttccctattttaaaaagcaaggtttttcaaaaacgataactcttgaaaaagaa
cgatggcaaggttatataaaggattatgatggcgttactcttatggaatgtgtcttaaat
cccaaagttgactatttgaatattccttccatgttaaaagcgcagaagatgtgcttaata
gagaaattgaaggaaataagtaatattcatatcgtttatcccggcttggatccggaggct
cgaaagaggattcggttggaagacattcctggtttaaaggaaggtcttgaacaaagtgaa
agatctcttggcaagacaataccccttgaatctcttgcggccccaagagatcctgcgtct
ttgcaagcacttcataaagaacttcaacacatattaactcaagttaagcagcatcaaagt
gcgtggccgtttttagaacctgttgatcctgaacagacaggtgctttggactattacgat
gttatcaagaatcctatcgacttgagaacaatacaagaacgtcttgatagaggagattat
tatgtgacaaaggaaatatttgctgcggatttaaagagaatgatcgagaattgtgaagct
tataacggtgaaaaacattttattacggaattggctcacaatttggagcgattttttaat
caaaaattgtaa

DBGET integrated database retrieval system