KEGG   Galdieria sulphuraria: Gasu_40760Help
Entry
Gasu_40760        CDS       T02926                                 

Definition
[pt] ribulose-bisphosphate carboxylase large chain (EC:4.1.1.39)
Orthology
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
gsl  Galdieria sulphuraria
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Class
Metabolism; Overview; Carbon metabolism [PATH:gsl01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:gsl00630]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:gsl00710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
Unknown
AA seq 493 aa AA seqDB search
MSQSIEEKSVQERTRIKNSRYESGVIPYAKMGYWNPDYKVKDTDVLALFRVTPQPGVDPI
EAAAAVAGESSTATWTVVWTDLLTAADLYRAKAYKVDQVPNNPEQYFAYIAYELDLFEEG
SIANLTASIIGNVFGFKAVKALRLEDMRLPLAYLKTFQGPATGVILERERLDKFGRPLLG
CTTKPKLGLSGKNYGRVVYEALKGGLDFVKDDENINSQPFMRWRERYLFTMEAVNKASSQ
TGEVKGHYLNVTAATMEEMYARANFAKELGSVIIMIDLVIGYTAIQTMAKWARDNDMILH
LHRAGNSTYSRQKNHGMNFRVICKWMRMAGVDHIHAGTVVGKLEGDPIITRGFYKTLLLP
KLERNLQEGLFFDMEWASLRKVMPVASGGIHAGQMHQLIHYLGEDVVLQFGGGTIGHPDG
IQAGATANRVALEAMILARNENRDYLTEGPEILREAAKSCGPLRTALDLWKDITFNYTST
DTSDFVETPTANI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaatcaatagaagaaaaatctgttcaagaacgtacaagaattaaaaattctaga
tatgagtcaggagtaataccatatgccaaaatgggatattggaatccagattataaagta
aaagatacagatgtactagcattatttagagttacccctcaacctggagtagatccaata
gaagcagctgcagctgtggctggcgaatcgtcaactgctacatggacagtagtttggaca
gatttattaacagcagcagatttatatagagcaaaagcttataaagtagatcaagtacct
aataatccagaacaatattttgcatatattgcatatgagctagacttatttgaagaagga
tcaattgcaaatttaactgcctcaataattggtaatgtatttggatttaaagcagttaag
gctctaagacttgaggacatgagattaccattagcatatcttaaaactttccaaggaccc
gcaactggagttattctagaaagagaaagacttgataaatttggtagacctttacttggt
tgtacaacaaaaccaaaacttggattatcaggtaaaaactatggtagagtagtttatgaa
gctttaaagggtgggctagattttgtcaaagatgatgaaaatattaactctcagcctttt
atgcgttggagagaaagatacttatttacaatggaagctgttaataaagcatcctcacaa
acaggagaagtcaaaggacattatttaaatgtaacagctgcaacaatggaagaaatgtat
gcacgtgctaatttcgcaaaagaattaggtagtgtaattataatgattgaccttgttata
ggctatactgctattcaaactatggcaaaatgggcaagagataatgatatgatcttacat
cttcatagagcaggtaattctacctattcaagacaaaaaaatcatggtatgaattttaga
gtaatttgtaaatggatgagaatggcaggagtagaccatattcatgctggaactgttgtt
ggaaaactagagggagatcctattattacaagaggattttataaaactcttcttttacct
aaactagagcgtaatttacaagaaggtttatttttcgatatggaatgggcatcactcaga
aaagtaatgccagtagcttctggtggtattcatgcaggacaaatgcatcaattaattcat
tatttaggtgaagatgtagtgttacaatttggtggaggaacaatcggacatccagatgga
atacaagctggtgctacagcaaatcgtgttgctttagaggcaatgatattagcaagaaat
gaaaaccgtgattatctgacagaaggtcctgagatattaagagaagcagctaaaagttgt
ggtccattaagaacagcattagatttatggaaggatattacattcaattatacatcaact
gatacttcagattttgtagaaacaccaactgcaaatatttaa

DBGET integrated database retrieval system