KEGG   Galdieria sulphuraria: Gasu_45900Help
Entry
Gasu_45900        CDS       T02926                                 

Definition
(RefSeq) 4-aminobutyrate transaminase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
gsl  Galdieria sulphuraria
Pathway
gsl00250  Alanine, aspartate and glutamate metabolism
gsl00280  Valine, leucine and isoleucine degradation
gsl00410  beta-Alanine metabolism
gsl00640  Propanoate metabolism
gsl00650  Butanoate metabolism
gsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Gasu_45900
   00650 Butanoate metabolism
    Gasu_45900
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gasu_45900
   00280 Valine, leucine and isoleucine degradation
    Gasu_45900
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Gasu_45900
Enzymes [BR:gsl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Gasu_45900
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Gasu_45900
Amino acid related enzymes [BR:gsl01007]
 Aminotransferase (transaminase)
  Class III
   Gasu_45900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 17086808
NCBI-ProteinID: XP_005704448
UniProt: M2XWE3
Position
Unknown
AA seq 467 aa AA seqDB search
MDACEYLKPEVFTNVPGPRSKTLIKQLNEVQDSRRVIVFTDMEKSRGCYLVDADGNVLLD
LFGQIASLPLGYNHPTLLEALKSPEFPSYFVQRPALAIFPPIQWYKVLKEALLSVAPKGL
SEVFTFCSCGSVANENAFKAAFIWKASIIKGRNTPTEEELNSAIGNRQPGAPEMAILSFE
KALHGRTLGALSTTHSKGIHKVDIPAFAWPIAPFPNLLFPLDKHRIQNEYEEEYCLQKIE
YILQTSAITIAGVIVEPILSEGGDLIATPSFYCKLRQLAEFYQIAFIVDEVQTGCGSTGT
FWAHEQWQLENPPDIVTFGKKMQVSGFYTKMEFRPPQPSRISNTWMGDPLRLLLCEKIIK
EIESRQLLERVSNVGAFISLGLEQLSESYPETISNVRGLGTFLAFDSSTESIRDIILTKA
RNKGLLLGECGIKTVRLRPPLILQLREAKVFLELLSQVLKTISSNSD
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggatgcttgtgaatatttaaagcccgaggtattcacaaatgtacctggacctcgttcc
aaaactttgataaaacaacttaatgaagttcaagactcaaggagagtcatagtatttaca
gatatggaaaagagtcgtggttgctatcttgtagatgccgatggaaacgttttactcgat
cttttcggtcaaattgcatctcttcctttgggatacaatcatcctacactacttgaagct
ctcaaaagtccagaattcccatcatactttgtacagagaccggctctcgcaatcttccct
ccaatacagtggtacaaagttttgaaagaagctttgttaagtgtagcacctaaaggactc
tcagaagtgtttactttttgtagttgtggatcagttgcgaatgaaaatgctttcaaagct
gcgttcatttggaaagcttcgataatcaaaggaagaaatactcctactgaggaagagttg
aatagcgctatcggaaatagacagccaggtgcacccgaaatggccatactgtcctttgaa
aaagctcttcatggtagaactttgggggctctatcgacaacacattcgaaaggaattcat
aaagtagatattccagcctttgcttggcctattgctccctttcctaatcttttgtttcca
ttggacaagcacagaatacagaatgaatatgaggaagaatattgcttgcaaaagatagaa
tacatactgcagacttctgctataaccattgctggagtcatagtcgaaccaatcctttct
gaaggaggggatttaatagccactccttctttctattgtaaattgaggcaattagcagaa
ttttatcagattgcttttatagtggacgaagtgcaaactggctgcggttcaactggaacg
ttttgggcacatgaacagtggcaactcgaaaatccgccagatattgtcacctttgggaag
aagatgcaggtgtcagggttttacacgaaaatggaatttcgaccccctcaaccgtcacgt
atttcaaacacttggatgggcgatcctcttcgtctgttgctttgtgaaaaaatcataaaa
gaaatagagagtaggcagttgctggagagagtcagtaacgttggagcctttattagcctt
ggtttggaacagctaagcgaaagttatccggaaacaatatccaatgtccgaggattagga
accttccttgcatttgatagttccactgagtctatccgtgatataattcttacaaaagcg
agaaacaagggtctccttctgggagaatgcggtataaagactgttcgtcttcgacctcct
ctcattttgcagctgagagaagccaaggtttttctcgaactcctttctcaagttttaaaa
actatatcttcgaattcagactaa

DBGET integrated database retrieval system