KEGG   Galdieria sulphuraria: Gasu_50970Help
Entry
Gasu_50970        CDS       T02926                                 

Definition
1,4-alpha-glucan branching enzyme isoform 1 (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gsl  Galdieria sulphuraria
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gasu_50970
Enzymes [BR:gsl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Gasu_50970
Exosome [BR:gsl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gasu_50970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 706 aa AA seqDB search
MKNKEKPCELKVVKDDPSLEPFCGDLLLRNKRYRKLKSEIEMKEGGLDQFSYGYSKFGLH
RCKGGLEFREVGFHIRCSIGIWLPGAKDLYLFGDFNDWKEPGYPLQRDSFGHFYGFIPDN
ADGSPAIAHASRIKLRVLTFDGQWLIRNPAXYQFVLHNRATFLIQNPTSFVYDAVFWSPP
EEWRYSWRYSTHATVPKSLRIYECHIGIATNEPKVGSFVEFAQKLIPKIKGLGYTAIQLM
AVMEHSYYASFGYHVTNFFAVSSRYGTPEDLKFLVDEAHNWGLYVLMDIVHSHASSNSND
GLNLLDGTDYQYFHHGERGNHPEWGSRLFDYSKWEVLRFLLSNARWFLEEYHFDGFRFDG
VTSMLYNHHGIGVSFSGDYKEYFGFQVDMDACVYLMLMNDILHHLYPESFLSIAEDVSGM
PTLCRPVEEGGIGFDYRLGMGIPDMWVDLVTNFRDEDWDMGRIVYGLTNRRWNEYTVGYV
ESHDQALVGDKTLAFRLMDAEMYSNMSIFVSPTDCIIRGIALHKMIRLITYALGGEAYLN
FMGNEFGHPEWIDFPRAGNNFSYQYARRQWNLVEDGTLRYQHLNAFDCEMHALESQHAFC
RSNLHQWITVHHNQDKVIAFEKGDGLLFVFNFHPVKSFSDYSIGVLWPGKYVLQLDSDRL
SLGGFDRIDQHVEHFTHPLKQHGRPHSLQLYLPNRSCQVYYCADLE
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaaagaaaaaccttgtgagttgaaggtagtgaaagatgacccttctttagaa
cccttttgtggagatttgctgttaaggaataagagatacagaaagttaaagagtgaaatc
gagatgaaggaaggtggacttgatcagttttcatatggatattccaagtttggtttgcat
cgatgtaaggggggtctcgaattccgagaagtaggtttccatatccgttgtagtattgga
atttggttacctggcgcaaaagatttgtatttatttggagattttaatgactggaaagaa
ccaggctatccattgcagagagactcctttggtcacttttatggttttattcctgacaac
gctgatggatctcctgctattgcccacgcttctcgtatcaaactccgtgtacttactttt
gatggtcagtggctgatccgcaatccagccngatatcaatttgtgttgcataatagggca
acttttcttattcagaatccgacgagctttgtttatgatgcggtattttggtcacctccg
gaagaatggcgatattcttggagatactccactcatgcaacggtcccgaaatctttgaga
atatacgaatgccatattggcattgccacaaatgagccaaaagttggctcctttgttgaa
tttgcccagaaactgattcctaaaatcaaaggcttgggttacactgccattcaattgatg
gcagttatggaacattcttattatgcatcatttggttatcatgtcacaaatttctttgct
gttagtagtcgttatggaactccagaagatttgaagtttttagtggacgaagctcacaac
tggggactttatgtgcttatggacatagtccactcacatgcctcttccaattctaatgat
ggtctcaatcttctcgatggaactgattatcagtactttcatcatggagaaagaggaaat
catccggaatggggtagtcgtttgtttgattattccaaatgggaagttcttcggtttctg
ttaagcaacgcacgttggtttttggaagaatatcattttgatggatttcggtttgatggg
gttacttctatgctttacaatcatcatggaataggagtttcattttctggtgattataag
gagtattttggatttcaagtggatatggatgcttgcgtatatttaatgttaatgaatgat
attttgcatcatctttatcctgagagctttctttccattgctgaggatgtgtctggaatg
cctactttgtgtcgaccagtagaagaaggcggtataggttttgactatcgtttgggaatg
ggtatacccgatatgtgggttgatctagtgaccaacttccgagatgaagactgggatatg
ggaagaatagtttatggtcttacaaatagaagatggaatgaatatactgttggatatgta
gaaagccacgatcaagcacttgttggagataagactttagcctttcgtctgatggatgca
gaaatgtatagcaacatgtcgatttttgtttcaccaacggactgcatcattcgtggaatt
gcattacacaaaatgattcgtcttataacttatgcattgggaggtgaagcatatctcaat
tttatgggaaatgaatttggtcatccagaatggattgactttcctcgtgcaggaaataat
ttttcatatcaatatgctcgaagacaatggaatttggtggaagatggaactttgcgttat
caacatttgaatgcctttgattgtgaaatgcatgccttggaaagtcagcacgcattctgt
agatccaatttgcatcagtggataactgttcatcataatcaagacaaagtcattgctttt
gaaaaaggagatggattactatttgtatttaattttcatcctgtgaaatccttttcagac
tattctattggagtgttatggccaggaaagtatgtgcttcagttggattcagatagactg
agtttgggagggtttgatcgtattgaccaacatgtcgagcattttactcatcctttgaaa
caacatggtcgtcctcattcactgcaactttatttacctaaccgttcgtgtcaagtgtat
tattgtgcagacttggaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system