KEGG   Galdieria sulphuraria: Gasu_52000Help
Entry
Gasu_52000        CDS       T02926                                 

Definition
stearoyl-CoA desaturase (delta-9 desaturase) (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
gsl  Galdieria sulphuraria
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gsl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Gasu_52000
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Gasu_52000
Enzymes [BR:gsl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Gasu_52000
Lipid biosynthesis proteins [BR:gsl01004]
 Desaturase
  First
   Gasu_52000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 317 aa AA seqDB search
MARTGLDGEYPNIVEKLNHTDDDKYLTLKELLCSRSFVFFFGVHILALAVFFVRFQWSFL
HLALASYCVRMLAITAGYHRYFSHRAFRTSRIFQFALACLGCSACQKGVLWWASWHRHHH
RYADTEQDVHSPYFGGFWWSHMGWFLFSDRHVAIQWHLIPDLAVYKELLWLEEHHYLPGI
ILAIVSYVMGGFGGFIWIFCLSTVILWHATFTVNSLCHLYGYQNFLCEYHESCNAKNNIL
LAILTLGEGWHNNHHSFMGSSKQGFEWWEIDLCYYFIRIMSSLGLIDSFRVPSSEQIELR
RLRSQTRSELSTSVSDH
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcgagaactggtttggatggagagtatccaaacatcgtagaaaaactcaaccacacg
gatgacgataaatatttaacgttgaaggagcttctgtgttcgagaagctttgttttcttt
ttcggcgtccatatcttagctttggctgtattctttgtacgctttcagtggagttttttg
catttggcacttgcttcctattgcgttcgtatgttggcgattaccgctggttatcaccgt
tactttagtcatcgcgcttttcgaaccagtaggatatttcagtttgccttggcttgttta
ggttgttccgcgtgtcaaaaaggtgtgctatggtgggcttcttggcatcgacaccatcat
cgttacgctgatactgaacaggatgtgcattctccctattttggtgggttttggtggtca
cacatgggctggtttctgttttcagacagacacgtggccattcagtggcacctcattcca
gatcttgccgtttataaagagttattatggttggaagaacaccattatttgccaggtatt
atacttgccatagtttcttatgttatgggcggttttggaggctttatttggattttttgt
cttagcactgttattttgtggcatgcaacatttactgtgaattccctttgtcatttgtat
ggatatcagaatttcttatgtgaatatcatgaatcttgtaatgcgaagaataatattcta
ttggccattcttacgctaggcgaaggctggcataacaaccatcatagttttatgggatca
tccaaacaaggttttgaatggtgggagatagatctctgttattactttatcagaataatg
tccagtttgggattgatagattcattcagagtcccaagttctgaacaaatagagttaaga
agattgaggtcccaaaccagatcggaattatccactagtgtcagtgaccattag

DBGET integrated database retrieval system