KEGG   Galdieria sulphuraria: Gasu_54340Help
Entry
Gasu_54340        CDS       T02926                                 

Definition
4-aminobutyrate transaminase (EC:2.6.1.19)
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
gsl  Galdieria sulphuraria
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Gasu_54340
   00650 Butanoate metabolism
    Gasu_54340
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gasu_54340
   00280 Valine, leucine and isoleucine degradation
    Gasu_54340
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Gasu_54340
Enzymes [BR:gsl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Gasu_54340
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Gasu_54340
Amino acid related enzymes [BR:gsl01007]
 Aminotransferase (transaminase)
  Class III
   Gasu_54340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 482 aa AA seqDB search
MKRVFSKLAFPRYEKPAIRTEIPGPRSRELLKEMDMLQETRTINFFMDTAKSQGTYAVDA
DGNVILDVFGHIASLPLGYNHPALAEAASKPEWLPFLLQRHALGVQPPVEWPKELRETLM
RVAPKGLSEVLTTCGCGSSANENAFKAAFIWKRARERHGSEPTTKELMSCMQNEAPGSPQ
KSILSFERSFHGRTMGCLSATRSKPIHKVDIPAFPWPVCPFPHLSYPLHEHERENREEED
RCLTRVEDLIRAHPIPVAGIIVEPILAEGGDHAATPYFYQQLRRIATSNGIAFIVDEVQT
GCGGTGKFWAHEYWQLDTPPDMVTFAKKMQVSGFFLKSEFRPAQAYRIYNTWMGDPLRML
QLHVIANVIEKENLLTRVSDTGNFVKMELERISRETPFLVANVRGSGTFLAFDMPNAATR
DQLLFEMRQKGVQMGGCGEVTIRLRPPLIFKQQDANILIETLELVLKNLKAHSSQKESLP
IH
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagtcttttctaagttagcttttccacgatatgaaaagcctgcgatacgtaca
gaaatacctggaccgaggtcaagagaacttttgaaggagatggatatgctgcaagaaaca
aggaccataaacttttttatggacacagccaagagtcaaggaacttatgcagttgatgcc
gatggaaatgtaatattggacgtttttggtcatatcgcttctttgcctttgggttacaat
catcctgcattggctgaggcagcttccaaacccgagtggctaccgtttctcttacaaaga
cacgctctaggtgtacaaccaccagtagagtggcccaaggaattgagagaaactttaatg
agagttgcgccaaaaggactttcggaggttctgacaacttgtggctgtggttcatcagcc
aacgaaaatgccttcaaggcagcatttatatggaaaagagcacgagaacgacacggctcg
gagccaacaactaaggagttgatgagttgtatgcaaaatgaggctcctggaagcccacaa
aagagcatcctttcctttgaaaggagttttcatggaagaacaatgggttgtttatcagcc
acgaggtcaaaacccatacataaagtggatattccagcgttcccttggccagtatgtcct
tttcctcatctttcttatcctttgcatgaacatgaacgtgaaaatcgtgaagaagaagat
cgctgtttgacgcgtgtggaagatttgattcgtgcacatccaatacccgtggcaggaatt
atcgttgaaccaattttggcagaaggaggtgatcatgctgcaactccatatttttatcaa
caattgcgaagaattgccacaagtaatggcatagcattcatagttgatgaagtacaaact
ggatgtggagggactggaaaattttgggctcatgaatattggcagttggatactccacca
gatatggttacttttgccaagaaaatgcaagtttccggtttctttttgaaaagtgaattc
agaccagctcaagcatacagaatatataacacatggatgggcgaccctcttcgcatgttg
caacttcatgtgattgcaaatgtgatcgaaaaggaaaatcttttgacacgtgtttctgat
actggaaattttgtaaagatggaacttgaaaggatatctcgtgagactccatttcttgtg
gccaacgttagaggaagtggaacctttttagcatttgatatgcccaatgcggccactcga
gaccaacttttattcgaaatgcgtcagaaaggtgtccaaatgggaggttgtggtgaagtt
actattcggctaagaccacctttgatattcaagcaacaagatgccaacattttgattgaa
actcttgaactggttctaaagaatctcaaggcgcattctagtcagaaggaaagccttcca
attcattaa

DBGET integrated database retrieval system