KEGG   Galdieria sulphuraria: Gasu_58260Help
Entry
Gasu_58260        CDS       T02926                                 

Definition
ubiquitin carboxyl-terminal hydrolase L3 (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
gsl  Galdieria sulphuraria
Brite
Enzymes [BR:gsl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Gasu_58260
Peptidases [BR:gsl01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Gasu_58260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 226 aa AA seqDB search
MTENKANSKRWIPLESNPQVLSEYLHKLGVEENVSLVDVLSPDLLDLVPRPVYAVILLYP
LHNQQSTREEIKQETSVYFCKQTISNACGTVALVHAVLNNIHRISCKKNSFFDKFYTSTV
HLSPHERATCLEQSEELDYLHSEFAQVGQSQAPGNTEEIDLHFVTFVSQQGKLIQLDGRL
EQPVVCGNCEEENLLQEATNVIKEQFMAKDPNEVRFNILALVHNES
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaataaagccaatagcaaacgttggatacctttggagtccaatcctcaagtc
ttatctgaatatctacacaagttgggtgtagaagaaaatgtttctctagtggacgtactt
tctccagacttactggatctcgttcctcgacctgtatacgccgtcatacttttgtatcca
cttcacaaccaacaaagcactagggaagaaataaaacaagaaactagtgtctatttttgt
aagcaaacgataagcaacgcttgtggaacagtggctctggttcacgctgtattgaataat
attcaccgaataagttgtaagaagaatagcttctttgacaagttttatacttcaactgtt
cacctttcacctcatgaaagagcaacttgtttggaacagagcgaagaattggactatcta
cactctgagtttgcacaagtaggtcaaagtcaggcacctggcaatactgaagaaatagac
ttgcactttgtcacttttgtatctcaacaaggaaaactaattcagttggatgggcgttta
gaacaacctgtcgtctgtggtaactgtgaagaagagaatctgttgcaagaagcaaccaat
gttatcaaagaacagtttatggcaaaagatcccaatgaagttcgtttcaatatcttggca
cttgttcataacgaatcctaa

DBGET integrated database retrieval system